Инвариантные паттерны внутренних белков пандемических вирусов гриппа

Тип работы:
Реферат
Предмет:
Медицина


Узнать стоимость

Детальная информация о работе

Выдержка из работы

Original articles
Оригинальные статьи
Russian Journal of Infection and Immunity = Infektsiya i immunitet Инфекция и иммунитет
2015, vol. 5, no. 4, pp. 323−330 2015, Т. 5, № 4, с. 323−330
ИНВАРИАНТНЫЕ ПАТТЕРНЫ ВНУТРЕННИХ БЕЛКОВ ПАНДЕМИЧЕСКИХ ВИРУСОВ ГРИППА
Е.П. Харченко
ФГБУИнститут эволюционной физиологии и биохимии им. И. М. Сеченова РАН, Санкт-Петербург, Россия
Резюме. Цель исследования состояла в поиске подходов распознавания по молекулярным характеристикам пандемических штаммов вирусов гриппа, А и в попытке выяснить, представляют ли угрозу птичьи штаммы в качестве вероятной причины новой пандемии гриппа. С помощью компьютерного анализа во внутренних белках (нуклеопротеин, матриксные белки М1 и М2, белки полимеразного комплекса РВ1, РВ2 и РА, неструктурный белок NS2- из-за вариабельности длины неструктурный белок NS1 был исключен из анализа) штаммов вируса гриппа, А пандемий 1918 (H1N1), 1957 (H2N2), 1968 (H3N2), 1977 (H1N1) и 2009 (H1N1) гг. осуществляли поиск в их первичных структурах инвариантных паттернов. Выявлено, что внутренние белки обучающей выборки пандемических штаммов характеризуются постоянством числа и позиций определенных аминокислот и наличием блоков протяженных инвариантных последовательностей. На основе этих выявленных паттернов инвариантности внутренних белков возможно было безошибочно идентифицировать пандемические штаммы в контрольной выборке. Пандемические штаммы, разделенные по их возникновению десятками лет и отличающиеся составом подтипов гемагглютинина и нейраминидазы (Н1, Н2, Н3 и N1, N2), имеют сильное сходство по внутренним белкам, образуя особое подмножество, от которого в разной степени «отдалены» непандемические штаммы. Это позволяет предположить, что в природе возникновение пандемических штаммов вируса гриппа, А связано с конвергенцией их внутренних белков к обнаруженным нами инвариантам пандемичности. Поскольку для выявления инвариантов пандемичности достаточно было обучающей выборки, состоящей из штаммов пандемий 1918 (H1N1), 1957 (H2N2), 1968 (H3N2), 1977 (H1N1) гг., то пандемию гриппа 2009−2010 гг. можно было бы предсказать на самой ранней ее стадии по данным секвенирования генома и протеома циркулировавших штаммов. По данным сравнительного анализа, внутренние белки птичьих штаммов H5N1 и H7N9 не близки к таковым пандемических штаммов, а для их нуклеопротеина свойственны особенности аминокислотного состава. Это дает основание полагать, что угроза возникновения новой пандемии гриппа, спровоцированной ныне циркулирующими птичьими штаммами, маловероятна. Инвариантные паттерны пандемических штаммов потенциально могут быть использованы для отслеживания предпандемических штаммов среди циркулирующих вирусов гриппа, А и выявления траектории формирования возможной пандемической опасности.
Ключевые слова: вирус гриппа А, внутренние белки, инвариантные паттерны, пандемический потенциал, распознавание образов, прогнозирование пандемий.
Адрес для переписки:
Харченко Евгений Петрович
194 223, Россия, Санкт-Петербург, пр. Мориса Тореза, 44, ИЭФБ им. И. М. Сеченова РАН.
Тел. /факс: 8 (812) 552-70-31 (служеб.) — 8 904 338-22-80 (моб.). E-mail: neuro. children@mail. ru
Библиографическое описание:
Харченко Е. П. Инвариантные паттерны внутренних белков пандемических вирусов гриппа // Инфекция и иммунитет. 2015. Т. 5, № 4. С. 323−330. Со1: 10. 15 789/2220−7619−2015−4-323−330
© Харченко Е. П., 2015
Contacts:
Eugene P. Kharchenko
194 223, Russian Federation, St. Petersburg, Toreza prospect, 44, Sechenov Institute of Evolutionary Physiology and Biochemistry of the Russian Academy of Sciences.
Phone/fax: +7 (812) 552-70-31 (offise) — 8 904 338-22-80 (mobile). E-mail: neuro. children@mail. ru
Citation:
Kharchenko E.P. The invariant patterns of the internal proteins of pandemic influenza viruses // Russian Journal of Infection and Immunity = Infektsiya i immunitet, 2015, vol. 5, no. 4, pp. 323−330. doi: 10. 15 789/2220−7619−2015−4323−330
DOI: http: //dx. doi. org/10. 15 789/2220−7619−2015−4-323−330
THE INVARIANT PATTERNS OF THE INTERNAL PROTEINS OF PANDEMIC INFLUENZA VIRUSES
Kharchenko E.P.
Sechenov Institute of Evolutionary Physiology and Biochemistry of the Russian Academy of Sciences, St. Petersburg, Russian Federation
Abstract. The purpose of the study was to find molecular recognition characteristics of pandemic strains of influenza A viruses and to find out whether avian strains are the probable cause of a new influenza pandemic. Computer analysis of the internal proteins (nucleoprotein, matrix protein Ml and M2 proteins polymerase complex PB1, PB2 and PA, non-structural protein NS2- because of the variability of the length the non-structural NS1 protein was excluded from the analysis) of influenza A virus pandemics in 1918 (H1N1), 1957 (H2N2), 1968 (H3N2), 1977 (H1N1) and 2009 (H1N1) strains was used for search of the invariant pattern primary structure. It was revealed that internal proteins of pandemic strains are characterized by the constancy of the number and positions of certain amino acids and the presence of extended invariant fragments. On the basis of these identified patterns of invariances in internal proteins it was possible to accurately identify pandemic strains in the control sample. Pandemic strains, divided by decades in their emergence and different composition of subtypes of hemagglutinin and neuraminidase (H1, H2, H3 and N1, N2), have strong relationship for their internal proteins, forming a special subset. This suggests that emergence of influenza A virus pandemic strains is related to convergence of their internal proteins to the detected pandemic invariants. To identify pandemic invariant patterns is enough to have the training set including strains of four pandemics (1918, 1957, 1968, 1977). Therefore the 2009−2010 pandemic influenza strain could be predicted at the earliest stage according to its genome and proteome sequencing. According to a comparative analysis, the internal proteins of avian strains H5N1 and H7N9, particularly their nuc-leoproteins, are not close to those of pandemic strains. This suggests that the threat of a new influenza pandemic, provoked by current circulating avian strains, is unlikely. Invariant patterns of pandemic strains can potentially be used to track pre-pandemic strains among circulating influenza A viruses and detect the formation of a possible trajectory of pandemic alert.
Key words: influenza virus A, internal proteins, invariant patterns, pandemic potential, image recognition, pandemic prognosis.
Эволюционная изменчивость вирусов гриппа типа, А (ВГА) находит явное проявление в многообразии их поверхностных белков: ге-магглютинина (НА) и нейраминидазы (НА) На сегодняшний день идентифицировано 17 подтипов НА и 10 подтипов НА [9]. Сопоставление структур НА позволило сгруппировать ВГА в 4 клада [11]. При всем многообразии существующих в природе комбинаций НА и НА, виновниками пандемий 1918, 1957, 1968, 1977 и 2009 гг. служили лишь подтипы Н1Н1, Н2Н2 и Н3Н2. Филогенетический анализ генома и протеома пандемических штаммов (ПШ) дает основание полагать, что пандемические штаммы 1957, 1968, 1977 и 2009 гг. ведут свое происхождение от ПШ птичьего происхождения 1918 г. [7, 13].
В отличие от НА и НА, первичная структура внутренних белков (ВБ) (мембранных белков (М1 и М2), нуклеопротеина (НР), белков по-лимеразного комплекса (РВ1, РВ2 и РА) и неструктурных белков (НБ1 и НБ2) консервативна. С возрождением ПШ 1918 г. [12, 14] уже доступны молекулярные характеристики ПШ пяти последних пандемий гриппа, что позволяет, отвлекаясь от филогенетического контекста, сформулировать вопрос: имеют ли ПШ такие особенности характеристик их ВБ, кото-
рые отличают их от непандемических штаммов (неПШ) (например, сезонных штаммов) — то есть возможно ли сегодня безошибочно распознать ПШ среди других штаммов и прослеживать возникновение пандемического потенциала у циркулирующих штаммов?
Исследование последних лет показали новые структурно-функциональные связи генома ВГА с организмом хозяина в инфекционном процессе. К примеру, выявлено, что геном вируса является источником регуляторных малых интерферирующих РНК (миРНК), открыты новые рамки считывания генома и др. [1]. Однако не исключено, что возникновение пандемического потенциала у ВГА связано (помимо возникновения новой комбинации НА и НА) и с приобретением ВБ уникальных типовых пандемических паттернов. Для проверки этого предположения нами с помощью компьютерного анализа сопоставлены первичные структуры белков ПШ и неПШ ВГА. Выявлено, что белкам М1, М2, НР, РВ1, РВ2, РА и НБ2 известных ПШ свойственно наличие инвариантных паттернов — общих, строго консервативных блоков в их первичных структурах, отличающих их от неПШ, которые могли бы быть использованы в качестве молекулярных маркеров пандемич-ности ВГА.
Материалы и методы
Анализ включал 75 штаммов ВГА, выделенных у человека, свиньи и птиц, в числе которых подтипы H1N1, H2N2, H3N2, H5N1, H7N9, H9N2, H10N3, H7N7, H4N6 и H6N1. Источником первичных структур их ВБ служили общедоступные в Интернете базы данных (http: // www. ncbi. nlm. nih. gov и http: //platform. gisaid. org). Из-за вариабельности длины NS1 белок был исключен из анализа. С помощью первого блока компьютерной программы первичные структуры ВБ были транслированы в их аминокислотные составы. Сравнение последних позволило выявить в первичной структуре М1, М2, NP, PB1, PB2, PA, и NS2 белков пяти ПШ обучающей выборки (H1N1 A/Brevig Mission/1/18, H1N1 А/ USSR/90/1977, H1N1 A/California/08/2009, H2N2 A/Japan/305/1957 и H3N2 A/Aichi/2/1968) постоянство числа и позиций для определенных аминокислот. Совокупность этих инвариантов по указанным белкам ПШ обозначена нами как инвариантные паттерны по аминокислотному составу (ИПАС) (см. табл. 1).
С помощью второго блока компьютерной программы на основе этих ИПАС был выполнен поиск в контрольной выборке других ПШ и анализ, по каким белкам и каким аминокислотам в них конкретный неПШ отличался от ПШ. Штамм исключался из числа ПШ, если выявлялось хотя бы одно отличие по ИПАС. Далее путем сравнения аминокислотных последовательностей ВБ пяти ПШ обучающей выборки для каждого белка выводили матрицу инвариантности первичной структуры (МИПС) ПШ (см. пример по белку М2 в табл. 3).
С помощью третьего блока компьютерной программы также был выполнен поиск в контрольной выборке других ПШ и определены отличия белков неПШ от МИПС. Исключение штамма из числа ПШ проводилось при наличии хотя бы одного отличия структуры их ВБ от МИПС.
Результаты
Первый подход распознавания ПШ был основан на анализе показателей количественного состава аминокислот ВБ у ПШ обучающей выборки, и он позволил выявить два типа ИПАС. Один из них охватывает те аминокислоты, общая численность которых и их позиция в первичной структуре соответствующих белков остается постоянной у всех ПШ. Например,
ТАБЛИЦА 1. ИНВАРИАНТНЫЕ ПАТТЕРНЫ ПО АМИНОКИСЛОТНОМУ СОСТАВУ ВНУТРЕННИХ БЕЛКОВ ПАНДЕМИЧЕСКИХ ШТАММОВ
Белок Инвариантные паттерны аминокислотного состава
Первый тип Второй тип
М1 E (17), W (1), F (7), G (16), M (14) P (8), C (3), Y (5)
М2 D (6), P (4), C (3), W (2), M (2) V (6), I (8)
NP C (6), W (6), F (17), Q (21)
PB1 H (10), P (32), C (10), Y (25), W (9), F (33) Q (31)
PB2 W (10), F (24) E (52), C (5), G (48)
PA W (12) E (77)
NS2 H (2), D (5), C (0), W (2)
Примечание: подчеркнутые аминокислоты инвариантны у всех штаммов ВГА.
в белке М2 всех ПШ обучающей выборки число остатков О* составляет 6 (см. табл. 1), и их позиции в первичной структуре у всех ПШ идентичны (табл. 3). Второй тип ИПАС относится к тем аминокислотам, число которых в соответствующем белке всех ПШ также является постоянным, но не все они характеризуется инвариантной локализацией в первичной структуре белка. Например, в том же белке М2 у всех ПШ число остатков V равно 6 (табл. 1), но позиция одного из остатков V в С-концевой части М2 у штамма (H1N1)A/CALIFORNIA/08/2009 (табл. 3) не совпадает с другими ПШ.
Как видно из представленной в таблице 1 сводки ИПАС обоих типов, каждый ВБ обладает собственным ИПАС: уникальным составом входящих в него аминокислот, их постоянной общей численностью в белке и, соответственно, строго определенными позициями в его первичной структуре для аминокислот, составляющих ИПАС первого типа. В ИПАС входят также инвариантные по числу и расположению аминокислоты, характерные для всех изолятов ВГА, и среди них, в частности, триптофан. Белок РВ1 имеет самый сложный, а белок РА — самый простой ИПАС. В целом сводка ИПАС первого типа охватывает 191 позицию аминокислот ВБ у ПШ. Совокупность ИПАС у ВБ позволила правильно распознать все (13 штаммов) ПШ контрольной выборки, исключив остальные 57 неПШ, причем прогноз был правильным как при использования только ИПАС первого типа, так и при совместном использовании обоих типов ИПАС. Но во втором случае различия
* В статье используется международный код аминокислот: А — аланин, С — цистеин, О — аспарагиновая кислота, Е — глутаминовая кислота, F — фенилаланин, G — глицин, Н — гистидин, I — изолейцин, К — лизин, Ь — лейцин, М — метионин, Н — аспарагин, Р — пролин, Q — глутамин, R — аргинин, 8 — серин, Т — треонин, V — валин, W — триптофан, Y — тирозин.
ТАБЛИЦА 2. ОТКЛОНЕНИЯ ВНУТРЕННИХ БЕЛКОВ НЕКОТОРЫХ ВИРУСОВ ГРИППА, А ОТ ИНВАРИАНТНЫХ ПАТТЕРНОВ ПО АМИНОКИСЛОТНОМУ СОСТАВУ ПАНДЕМИЧЕСКИХ ШТАММОВ
Н11Ч1 А/РиЕЯТО Я! С0/8/1934 (й = 4) [ЫР: Р (+1) — М2: й (-1) — РВ2: Р (+1) — Ы82: Н (+1)]
Н11Ч1 А/й!8ТЯ!СТ ОР С0ШМВ! А/№АМС-1 154 048/2008 (й = 5) [М2: й (+1), С (-1) — РВ1: У (+1) — Ы82: Н (+2)]
Н1Ы1 А/Мехюо/4115/2009 (й = 0)
Н5Ы1 А/!пСопев1а/5/ (й = 3) [ЫР: Р (+1), 0(+1) — РВ2: Р (-1)]
Н7№ А/8ИапдИа½/2013 (й = 7) [ЫР: Р (+1), 0(1+) — М1: Р (1), 0(+1) — М2: й (-2), М (+1)]
Примечание: й — общее число («инвариантных») аминокислот, по которым ВБ вируса отличаются от ИПАС ПШ. В квадратных скобках указаны белки и какие в них («инвариантные») аминокислоты в избытке (+) или в недостатке (-) по сравнению с ИПАС ПШ.
неПШ от ПШ были более высокими. При этом достаточно было воспользоваться инвариантными паттернами лишь М1, М2, НР, РВ1, РВ2 и РА белков, не привлекая данные по N82 белку. В таблице 2 для примера представлены данные по части штаммов контрольной выборки. Из нее видно, что неПШ отличаются от ПШ по разным сочетаниям белков, причем эти отклонения проявляются как в избыточном, так и в недостаточном количестве инвариантных (для ПШ) аминокислот. Примечательно, что подтипы Н5№ и Н7№ содержат в избытке аминокислоты Q и F в белке НР, что является одной из характерных особенностей НР птичьих штаммов.
Второй подход распознавания «молекулярных образов» ПШ был основан на построении МИПС белков ПШ обучающей выборки. Пример построения МИПС показан на М2 белке в таблице 3. В ней верхние 5 строк представлены первичными структурами белка М2 пяти ПШ обучающей выборки. Из них выводится МИПС М2 (строка 6), в которой обозначены только строго консервативные позиции аминокислот, а точками представлены позиции заменяемых у разных ПШ аминокислот.
Последние, как правило, являются изофунк-циональными по размеру, гидрофобности или заряду. Ниже матрицы инвариантности М2 представлены первичные структуры М2 птичьих штаммов Н5М А/1пёопе81а/5/2005 и Н7Ю А/8Иап§ Иа½/2013 (соответственно строки 7 и 8), вызывающих тревогу из-за потенциальной опасности трансформации их в пандемические. Сравнение МИПС с первичными структурами ВБ штаммов контрольной выборки проводилось только по консервативным позициям. Как видно из таблицы 3, в случае белка М2 у Н5№ А/1пёопеБ1а/5/2005 имеются отличия (они подчеркнуты) по двум, а у Н7№ А/8Иап§ Иа½/2013 по шести позициям.
Распознавание ВГА на основе МИПС позволило также успешно идентифицировать в контрольной выборке все ПШ и выявило, что ПШ являются наиболее близкими по родству их ВБ. В таблице 4 в качестве иллюстрации представлены различия по МИПС семи ВБ для четырех неПШ ВГА. Видно, что от штамма к штамму отличия от МИПС по каждому ВБ заметно варьируют. Если учесть сильные различия между ВБ по длине, то самыми консервативными являются белки полимеразного комплекса.
ТАБЛИЦА 3. ПРИМЕР ПОСТРОЕНИЯ МАТРИЦЫ ИНВАРИАНТНОСТИ ПЕРВИЧНОЙ СТРУКТУРЫ ДЛЯ БЕЛКА М2 ПАНДЕМИЧЕСКИХ ШТАММОВ
1. MSLLTEVETPTRNEWGCRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSTEGVPESMREEYRKEQQSAVDVDDGHFVNIELE
2. MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLKRGPSTEGVPESMREEYRKEQQNAVDADDSHFVNIELE
3. MSLLTEVETPTRSEWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE
4. MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFKHGLKRGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
5. MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLKRGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
6. MSLLTEVETP.R. ЕW. CRC. DSSDPLV. AA. IIGILHLILWI. DRLFFKCIYR____GLKRGPSTEGVPESMREEY. EQQ. AVD. DD. HFV. IELE
7. MSLLTEVETPTRNEWECRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLKRGPSKTGVPESMREEYRQEQQSAVDVDDGHFVNIELE
8. MSLLTEVETPTRTGWECNCSGSSEPLVVAANIIGILHLILWILDRLFFKCIYRRFKYGLKRGPSTEGMPESMREEYRQEQQNAVDVDDGHFVNIELK
Примечание: 1 — (Н1Ш)А/Вгеу|д М1зз1оп/1/18- 2 — (Н1Ш)А/и88Р/90/1977- 3 — (Н1111)А/САиР0Р11!А/08/2009- 4 — (Н2Ы2)АД1арап/305/1957- 5 — (Н3Ы2)А/А!СН!/2/1968- 6 — матрица инвариантности белка М2 для ПШ- 7 — (Н5Ш)А/ !пСопев1а/5/2005- 8 — (Н7Ы9) А/8Ь|апдЬ|а½/2013. В матрице белка М2(6) подчеркнуты аминокислоты, инвариантные для ПШ по количеству и расположению в первичной структуре (см. табл. 1). В строках 7 и 8 подчеркнуты те позиции аминокислот, которые отличаются от матрицы инвариантности М2(6).
ТАБЛИЦА 4. ОТЛИЧИЯ ПО ЧИСЛУ АМИНОКИСЛОТ ВНУТРЕННИХ БЕЛКОВ НЕКОТОРЫХ ШТАММОВ ВИРУСА ГРИППА, А ОТ МАТРИЦ ИНВАРИАНТНОСТИ ПАНДЕМИЧЕСКИХ ШТАММОВ
Штаммы Внутренние белки
M1 M2 NP PB1 PB2 PA NS2 E
H1N1 A/PuertoRico/8/1934 1 4 6 7 8 4 2 32
H1N1 A/District of Columbia/ WRAMC-1 154 048/2008 3 3 6 7 10 8 5 42
H1N1 A/Mexico/4115/2009 0 0 0 0 0 0 0 0
H5N1 A/Indonesia/5/2005 5 2 5 5 5 8 4 34
H7N9 A/Shanghai/2/2013 2 6 8 6 4 11 3 40
Примечание:? — сумма указанных по горизонтали значений отклонений всех ВБ штамма от МИПШ.
По суммарному показателю наиболее удален от ПШ штамм H1N1 A/District of Columbia/ WRAMC-1 154 048/2008. Птичий штамм H5N1 A/Indonesia/5/2005 ближе к ПШ, чем штамм H7N9 A/Shanghai/2/2013.
Обсуждение
Данные выполненного нами анализа свидетельствуют о том, что распознавание «молекулярных образов» ПШ, основанное на учете разных аспектов первичной структуры ВБ ВГА, оказалось успешным, правильно выделив все ПШ и исключив неПШ в контрольной выборке ВГА. Оно реализовалось благодаря существо -ванию в ВБ у ПШ комплекса инвариантнос-тей, полное сочетание которых не свойственно неПШ. Примечательно, что отличия каждого неПШ от ПШ затрагивают все ВБ (табл. 1 и 4), значительно превосходя заложенный в правило дифференцирования ПШ от неПШ минимальный порог: хотя бы одно отличие. Хотя первый подход распознавания, основанный на ИПАС, является, по существу, «усеченным» вариантом второго подхода, однако по эффективности он не уступает последнему. ПШ, разделенные по их возникновению десятками лет и отличающиеся составом подтипов НА и NA (Н1, Н2, Н3 и N1, N2), имеют сильное сходство по М1, М2, NP, PB1, PB2, PA и NS2 белкам, образуя особое подмножество, от которого на разных расстояниях «отдалены» неПШ. Некоторые неПШ могут быть очень близки и даже идентичны МИПС какого-то одного белка ПШ, но не по всем ВБ. ИПАС и МИПС отдельных белков составляют совокупный инвариантный паттерн ВБ ПШ вируса гриппа А.
Возникает несколько вопросов, и первый из них — можно ли было предсказать пандемию 2009−2010 гг. и возможно ли прогнозировать будущие пандемии? На первую часть этого вопроса можно ответить утвердительно. В наших двух подходах распознавания ПШ в качестве обучающей выборки было бы достаточно
иметь, вместо пяти, четыре штамма пандемий 1918, 1957, 1968 и 1977 гг., чтобы точно определить принадлежность того или иного штамма к ПШ при условии, что в природе возникновение ПШ ВГА связано с конвергенцией его ВБ к выявленным нами инвариантам пандемич-ности. Это условие у вируса пандемии 2009 г. проявилось, и, следовательно, используя описываемые нами подходы распознавания ПШ, пандемию 2009−2010 гг. можно было предсказать на самой ранней ее стадии по данным сек-венирования генома и протеома циркулировавших штаммов.
Некоторые авторы считают, что «абсолютным требованием для возникновения пандемии, по-видимому, является смена НА» [13]. Если признать вспышку эпидемии гриппа в 1977 г. ограниченной пандемией (а характеристики вызвавшего ее штамма Н1Н1 A/USSR/90/1977 точно соответствуют ПШ), то пандемия гриппа 2009 г. была инициирована возбудителем без смены по отношению к пандемии 1977 г. подтипов НА и НА. Считается, что смена подтипа НА позволяет обойти сформировавшийся популяционный иммунитет к ранее циркулировавшим штаммам ВГА. Однако возможен и другой сценарий: смены самого подтипа НА у возбудителя не происходит из-за высокой мимикрии в его структуре фрагментов различных белков человека, что делает вирус плохо распознаваемым иммунной системой и не препятствует инфекционному процессу с более слабым проявлением патогенности/вирулентности. Либо наоборот: из-за резко выраженных изменений в НА, отличающих его от ранее циркулировавших штаммов ВГА и штаммов, вызвавших предшествовавшую пандемию, ПШ оказывается высоковирулентным. Анализ иммуноэпитопов НА и НА у ПШ 1918, 1977 и 2009 гг. свидетельствует о том, что ПШ 2009 г., по сравнению с ПШ 1918 и 1977 гг., существенно меньше чужероден для иммунной системы человека [2] (то есть пандемия 2009 г.
протекала по первому сценарию), объясняя, по крайней мере частично, почему при пандемии 2009 г. не произошло смены подтипа НА и более слабую вирулентность ПШ 2009 г.
В связи с циркуляцией в природе птичьих штаммов, опасных для человека, естественным представляется вопрос: может ли каждый птичий ВГА, способный инфицировать людей, приобрести пандемичность через последовательно генерируемые изменения фрагментов генома, не лимитированные структурными или функциональными эволюционными ограничениями, или же пандемические вирусы являются редкими образованиями, сложная констелляция фрагментов генома которых не может быть легко сформирована, кроме как посредством редких и пока неясных механизмов [9]. Изначально озабоченность исследователей была вызвана вирусом Н5№. Хотя экспериментально показана возможность обретения ими (через серию мутаций [5] либо реассортацию, ассоциированную с мутациями [6]) трансмиссии воздушно-капельным путем среди других животных, опасения по поводу Н5№ стали несколько ослабевать на фоне новой возникшей вспышки гриппа, виновником который стал другой птичий вирус. Очередной раунд тревожности связан с вирусом Н7Ш [4, 10].
В генерации новых штаммов ВГА, природа, как известно, активно использует и реассорта-цию, и мутации, и, хотя репликационная система ВГА не обладает строгой редактирующей способностью, само многообразие подтипов НА и НА у ВГА, способных распознавать рецепторы человеческих клеток, служат свидетельством слабого эволюционного ограничения на уровне НА и НА и, соответственно, примером того, что одна и та же функция может реализоваться разными структурами. В то же время, существенную консервативность на уровне белков полимеразного комплекса (или же НБ2 белка) можно рассматривать как проявление функционального ограничения. Модификации птичьих штаммов Н5Н1 показали, что обретение ими трансмиссивности среди экспериментальных животных также можно достичь разными путями [5, 6]. Однако лабораторные модели часто не приемлемы в самой природе. Природа формирования пандемичности является более сложной. Выявление у ПШ инвариантных матриц их ВБ свидетельствует, что возникновение пандемичности требует весьма строгого консенсуса первичных структур вирусных ВБ и, в частности, белков полимеразного комплекса, который проявляет, как показано [3], взаимодействие со множеством белков хозяина.
Из-за стохастичности мутационного процесса и связанных с ней хаотичностью и неопределенностью изменений первичных струк-
тур белков, возможности возникновения ПШ прямо из птичьих штаммов через серийные мутации представляются весьма ограниченными. Ведущим механизмом в возникновении ПШ, судя по данным филогенетического анализа, является реассортация компонентов генома вируса гриппа, сопровождаемая непрерывно протекающим мутационным процессом. В природе ВГА репродуцируется с континуумом изменений первичных последовательностей составляющих их белков, и отдельные штаммы разных хозяев могут содержать какой-то из белков, близкий или идентичный соответствующей МИПС. Такие штаммы вирусов не являются редкостью. Так, М1 белок штамма H1N1 A/PuertoRico/8/1934 отличается от соответствующей МИПС по одной позиции (табл. 4). Реассортация приводит к возникновению множества комбинаций генов, и наиболее жизнеспособными, возможно, оказываются вирио-ны с констелляцией генов, обеспечивающей наибольшую близость с МИПС. Появление у реассортантов 2−3 белков с МИПС соответствующих белков можно было бы рассматривать как возникновение предПШ, способных формировать траектории пандемичности. Поскольку П Ш обладают наиболее высокими характеристиками по репродукции и трансмис-сивности, то приближающиеся к ним предПШ будут, вероятно, обладать более высокой выживаемостью и способностью выступать в качестве аттрактора новых реассортаций, обновляя и еще более приближая состав компонентов их генома к ПШ. Этот гипотетический сценарий способствует быстрому и неожиданному возникновению штамма с пандемическими свойствами, как это случилось с пандемией 2009 г.
Если в отношении происхождения возбудителя пандемии 1918 г. данные филогенетического анализа противоречивы, то не вызывает сомнения, что три последние пандемии явились результатом реассортации предсуществовав-ших адаптированных к человеку или к свинье вирусов с импортированием генов из птичьих вирусов, но не из-за адаптации de novo птичьих ВГА к человеку. Ни одна из пяти последних пандемий, как известно, не была ассоциирована по времени с эпизоотией у домашних или перелетных птиц [9]. Хотя для гриппозной инфекции видовые барьеры низки, различия человеческих и птичьих вирусов гриппа по доминированию у них разных субтипов НА и NА, как и особенности первичных структур их ВБ, служат высоким барьером для трансмиссии птичьих вирусов от человека человеку и последующей продуктивной инфекции [9]. Из таблиц 2 и 4 видно, что даже при высокой консервативности ВБ среди ВГА, штаммы H5N1 и H7N9 не близки к ПШ, и по своим характеристикам
не отличаются от сезонных штаммов НШ1. Если решать дилемму с Н5№ и Н7№ - является ли эти птичьи штаммы «отступающим риском или грядущей катастрофой» человечества [8] - то данные по распознаванию образов ВБ ПШ свидетельствуют о большей вероятности первого.
Возвращаясь к вопросу о прогнозировании возникновения будущих пандемий гриппа, хотелось бы подчеркнуть, что выполненный нами анализ позволяет предположить, что ПШ 1918, 1957, 1968, 1977 и 2009 гг. обрели свой пандемический потенциал конвергенцией их ВБ к пандемическим инвариантам- то есть пандемический потенциал ВГА формировался уникальной комбинацией ВБ, которая случайно и приближенно воссоздавалась через различные промежутки времени, исчисляемые десятками лет. Если эта комбинация молекулярных инвариантных паттернов служит фундаментальной основой пандемичности и воспроизводилась ранее в пандемиях минувших столетий, то прогнозирование будущих пандемий гриппа не представляется уже нереальным или недостижимым. Трудность заключается в необходимости регулярного мониторинга множества циркулирующих в природе штаммов ВГА у разных хозяев и обязательного сек-венирования их генов для контроля распространения тех штаммов, которые содержат хотя
бы один из белков, приближающийся к ИПАС и МИПС соответствующего белка ПШ. Циркуляция и реассортация ВГА в разных видах животных и возможность адаптации их к разным хозяевам требуют тесной координации служб надзора в здравоохранении и ветеринарии, единого методологического уровня анализа и открытого обмена полученными данными.
Заключение
С помощью компьютерного анализа установлено, что ВБ пандемических штаммов ВГА характеризуются наличием инвариантных паттернов в их первичных структурах, что позволило посредством двух подходов распознавания образов безошибочно идентифицировать ПШ в контрольной выборке. Инвариантные паттерны ПШ потенциально могут быть использованы для отслеживания предПШ среди циркулирующих ВГА и выявления траектории формирования возможной пандемической опасности.
Благодарности
Автор выражает признательность О. И. Киселеву, чья книга «Геном пандемического вируса гриппа А/НШ1У-2009», побудила к написанию данной статьи.
Список литературы/References
1. Киселев О. И. Геном пандемического вируса гриппа A/H1N1V-2009. СПб. -М.: Компания «Димитрейд График Групп», 2011. 163 с. [Kiselev O.I. Genom pandemicheskogo virusa grippa A/H1N1V-2009 [The genome of pandemic influenza viruis A/ H1N1V-2009]. St. Petersburg-Moscow: Dimitrade Grafic Group, 2011. 163p. ]
2. Харченко Е. П. Иммуноэпитопный континуум белков и возможные его проявления // Российский иммунологический журнал. 2013. T. 7, № 16. C. 179−180 [Kharchenko E.P. Immune epitope continuum of the proteins and possible its applications. Rossiiskii immunologicheskii zhurnal = Russian Immunological Journal, 2013, vol. 7, no. 16, pp. 179−180. (In Russ.)]
3. Bortz E., Westera L., Maamary J., Steel J., Albrecht R.A., Manicassamy B., Chase G., Martinez-Sobrido L., Schwemmle M., Garcia-Sastre A. Host- and strain-specific regulation of influenza virus polymerase activity by interacting cellular proteins. MBio, 2011, vol. 2, no. 4, doi: 10. 1128/mBio. 151−11
4. Fouchier R.A.M., Kawaoka Y., Cardona C., Compans R.W., Garcia-Sastre A., Govorkova E.A., Guan Y., Herfst S., Oren-stein W.A., Peiris J.S., Perez D.R., Richt J.A., Russell C., Schultz-Cherry S.L., Smith D.J., Steel J., Tompkins S.M., Topham D.J., Treanor J.J., Tripp R.A., Webby R.J., Webster R.G. Gain-of-function experiments on H7N9. Science, 2013, vol. 341, pp. 612−613. doi: 10. 1126/science. 341. 6146. 612
5. Herfst S., Schrauwen E.J.A., Linster M., Chutinimitkul S., de Wit E., Munster V.J., Sorrell E.M., Bestebroer T.M., Burke D.F., Smith D.J., Rimmelzwaan G.F., Osterhaus A.D., Fouchier R.A. Airborne transmission of influenza A/H5N1 virus between ferrets. Science, 2012, vol. 336, pp. 1534−1541. doi: 10. 1126/science. 1 213 362
6. Imai M., Watanabe T., Hatta M., Das S.C., Ozawa M., Shinya K., Zhong G., Hanson A., Katsura H., Watanabe S., Li C., Kawa-kami E., Yamada S., Kiso M., Suzuki Y., Maher E.A., Neumann G., Kawaoka Y. Experimental adaptation of an influenza H5 haemagglutinin (HA) confers respiratory droplet transmission to a reassortant H5 HA/H1N1 virus in ferrets. Nature, 2012, vol. 486, no. 7403, pp. 420−428. doi: 10. 1038/nature10831
7. Morens D.M. Editorial commentary: pandemic H5N1: receding risk or coming catastrophe? Clin. Infect. Dis., 2013, vol. 56, no. 9, pp. 1213−1215. doi: 10. 1093/cid/cit051
8. Morens D.M., Taubenberger J.K., Fauci A.S. H7N9 avian influenza A virus and the perpetual challenge of potential human pandemicity. MBio, 2013, vol. 4, no. 4. doi: 10. 1128/mBio. 445−13
9. Morens D.M., Taubenberger J.K. Pandemic influenza: certain uncertainties. Rev. Med. Virol., 2011, vol. 21, pp. 262−284. doi: 10. 1002/rmv. 689
10. Morens D.M., Taubenberger J.K., Fauci A.S. Pandemic influenza viruses — hoping for the road not taken. N. Engl. J. Med., 2013, vol. 368, no. 25, pp. 2345−2348. doi: 10. 1056/NEJMp1307009
11. Russell R.J., Gamblin S.J., Haire L.F., Stevens D.J., Xiao B., Ha Y., Skehel J.J. H1 and H7 influenza haemagglutinin structures extend a structural classification of haemagglutinin subtypes. Virology, 2004, vol. 325, no. 2, pp. 287−296. doi: 10. 1016/ j. virol. 2004. 04. 040
12. Taubenberger J.K., Hultin J.V., Morens D.M. Discovery and characterization of the 1918 pandemic influenza virus in historical context. Antivir. Ther., 2007, vol. 12, no. 4, pp. 581−591.
13. Taubenberger J.K., Baltimore D., Doherty P.C., Markel H., Morens D.M., Webster R.G., Wilson I.A. Reconstruction of the 1918 influenza virus: unexpected rewards from the past. MBio, 2012, vol. 3, no. 5. doi: 10. 1128/mBio. 201−12
14. Taubenberger J.K., Morens D.M. Influenza: the once and future pandemic. Public Health Rep., 2010, vol. 125(suppl. 3), pp. 16−26.
Автор:
Харченко Е. П., д.б.н., ведущий научный сотрудник Института эволюционной физиологии и биохимии им. И. М. Сеченова, Санкт-Петербург, Россия.
Поступила в редакцию 21. 09. 2015 Отправлена на доработку 19. 10. 2015 Принята к печати 29. 10. 2015
Author:
Kharchenko E.P., PhD, MD (Biology), Senior Researcher, Sechenov Institute of Evolutionary Physiology and Biochemistry of the Russian Academy of Sciences, St. Petersburg, Russian Federation.
Received 21. 09. 2015 Revision received 19. 10. 2015 Accepted 29. 10. 2015

ПоказатьСвернуть
Заполнить форму текущей работой