Одноцепочечное антитело против гликопротеина е вируса клещевого энцефалита

Тип работы:
Реферат
Предмет:
Медицина


Узнать стоимость

Детальная информация о работе

Выдержка из работы

та, увеличением числа родов у данного контингента женщин, увеличением числа сочетанных инфекций (ИСУ, ВПГ, ВПЧ и т. д.). На всех этапах течения ВИЧ-инфекции у беременных женщин выявляется дисбаланс иммунной системы, проявляющийся дефицитом Т-лимфоцитов и их субпопуляций. Отмечается прямая корреляция снижения СБ4 с клиническим прогрессированием заболевания. Использование метода иммуноцитохимии и выявление антигена ВИЧ в цервикальной слизи у всех обследуемых женщин свидетельствует о высоком риске интранатального инфицирования плода при
ведении родов через естественные родовые пути. Учитывая тот факт, что степень выраженности экспрессии антигена ВИЧ не соответствует маркеру активности вирусного процесса — величине иммуносупрессии (уровню СБ4), необходимо рекомендовать данную методику для практического здравоохранения, как показатель степени риска интранатального инфицирования плода. Выбор тактики родоразрешения ВИЧ-инфицированных женщин должен базироваться на количественной оценке перинуклеарной экспрессии антигена ВИЧ в лимфоцитах цервикальной слизи.
ЛИТЕРАТУРА
1. Городничева Ж. А., Савельева И. С. Репродуктивное поведение ВИЧ-инфицированных женщин. // Акушерство и гинекология. — 2005. — № 6. — С. 61−63.
2. Шахгильдян В. И., Шипулина О. Ю., Сильц В. В. и др. Значение лабораторных маркеров активной репликации цитомегаловируса у ВИЧ — инфицированных
беременных женщин при оценке риска врожденной и внутриутробной ЦМВ-инфекции//Акушерство и гинекология. — 2005. — № 2. — С. 24−29.
3. De Martino M., Rossi M., Azzari C., et al. IL-6 syntesis and IgE overproduction in children with perinatal human immunodeficiency virustype 1 infection. // Ann. Allergy Asthma Immunol. — 1999. — Vol. 82. — P. 212−216.
Адрес для переписки: Иглина М. А. УлГУ, ИМЭиФК, кафедра акушерства и гинекологии, ст. преподаватель. Контактные телефоны: (8422) 32−00−14 рабочий, (8422) 97−31−63 мобильный. e-mail: marinaiglina@mail. ru
© ЛЕВАНОВ Л.Н., МАТВЕЕВ Л.Э., ЮН Т.Э., ЛЕБЕДЕВ Л.Р., ШВАЛОВ А.Н., БАЙКОВ И.К., МАТВЕЕВА В.А., РИХТЕР В.А., ТИКУНОВА Н.В. — 2008
ОДНОЦЕПОЧЕЧНОЕ АНТИТЕЛО ПРОТИВ ГЛИКОПРОТЕИНА Е ВИРУСА КЛЕЩЕВОГО ЭНЦЕФАЛИТА
Л. Н. Леванов, Л. Э. Матвеев, Т. Э. Юн, Л. Р. Лебедев, А. Н. Швалов, И. К. Байков,
В. А. Матвеева, В. А. Рихтер, Н. В. Тикунова (ФГУН Государственный научный центр вирусологии и биотехнологии «Вектор», Новосибирская область, п. Кольцово- Институт химической биологии и фундаментальной медицины СО РАН, Новосибирск-
Новосибирский государственный университет)
Резюме. На основе кДНК-фрагментов генов, кодирующих вариабельные домены тяжелой и легкой цепей моноклонального антитела (МКА) против гликопротеина Е вируса клещевого энцефалита (КЭ), сконструирована рекомбинантная плазмидная ДНК pSC10C2. Эта плазмида обеспечивала экспрессию одноцепочечного антитела sc10C2 против вируса КЭ в клетках Escherichia coli. Продуцируемое антитело связывало вирус КЭ, штамм 205, и рекомбинантный белок Е вируса КЭ. Константа аффинности очищенного sc10C2 составила (1,2 ± 0,3) х 107 М-1.
Ключевые слова: вирус клещевого энцефалита, одноцепочечное антитело против гликопротеина Е.
SCFV-ANTIBODY AGAINST GLYCOPROTEIN E OF TICK-BORNE ENCEPHALITIS VIRUS
L. N. Levanov, L. E. Matveev, T. E. Yun, L. R. Lebedev, A. N. Shvalov, I. K. Baykov, V. A. Matveeva,
V. A. Richter, N. V. Tikunova
(Federal State Research Institution State Research Center of Virology and Biotechnology «Vector», Kol’tsovo, Novosibirsk region Institute of Chemical Biology and Fundamental Medicine, Sibirian Branch of Russian Academy of Sciences,
Novosibirsk Novosibirsk State University, Russia)
Summary. The recombinant plasmid DNA pSC10C2 was constructed on the basis of cDNA fragments of the genes encoding variable domains of the heavy and light chains of MAb against glycoprotein E of Tick-Borne encephalitis virus (TBEV). This plasmid provided an expression of scFv-antibody sc10C2 against TBEV in Escherichia coli cells. The produced antibody was able to bind TBEV, strain 205, and recombinant protein E of TBEV. Affinity of purified sc10C2 was (1,2 ± 0,3) x 107 M-1.
Key words: tick-borne encephalitis virus, scFv-antibody against glycoprotein E.
Клещевой энцефалит (КЭ) — острое природноочаговое инфекционное заболевание нервной системы, передающееся иксодовыми клещами. Возбудителем заболевания является вирус КЭ, представитель семейства Flaviviridae. Современная эпидемическая ситуация в отношении КЭ характеризуется значительным ростом заболеваемости [1, 2]. Эта закономерность характерна не только для России, где регистрируется большая часть случаев заболеваний, но и для многих европейских стран. В РФ за последние годы заболеваемость КЭ возросла в девять раз и достигла 11 000 случаев в год [1]. В настоящее время единственным специфическим средством лечения этого заболевания является гамма-глобулин против вируса КЭ, получаемый из крови им-
мунизированных людей. Высокая стоимость данного препарата и возможный биологический риск при его применении делают необходимым поиск альтернативных терапевтических средств. В качестве альтернативы гамма-глобулину могли бы использоваться моноклональные антитела человека, однако, к настоящему времени МКА человека, специфически направленные к вирусу КЭ, отсутствуют.
В последние годы внимание исследователей привлекают рекомбинантные антитела, которые можно получать в апробированных экспрессионных системах в больших количествах в отличие от иммуноглобулинов, получаемых при иммунизации животных и человека. Среди них большой интерес представляют, в частности,
химерные антитела, в которых мышиные константные домены заменены на человеческие. Такие антитела, как правило, сохраняют специфичность и биологические свойства исходных моноклональных антител. Кроме того, они обладают меньшей иммуногенностью по сравнению с МКА животных, а также характеризуются повышенной стабильностью in vivo, что, по-видимому, обусловлено наличием видоспецифических аминокислотных остатков, которые участвуют в контроле метаболизма иммуноглобулинов [3]. Поэтому рекомбинантные химерные антитела против вируса КЭ, в случае наличия у них вируснейтрализующих и протективных свойств, были бы полезны для профилактики и терапии этого заболевания.
Одним из основных биохимических показателей для любого антитела, предназначенного для медицинского применения, является константа аффинности, которая характеризует прочность связывания антитела с целевым антигеном. Как было неоднократно показано, антитела с высокой константой аффинности более эффективны в терапии, поскольку они успешнее конкурируют с естественными лигандами за целевой рецептор [4]. Кроме того, от аффинности зависит время пребывания антитела в организме, а также терапевтическая доза препарата.
Для того чтобы оценить, какая будет аффинность у полноразмерных антител, обладающих двумя центрами связывания с антигеном, возможно измерение аффинности их моновалентных аналогов с поправкой на бивалентную природу молекулы иммуноглобулина [5]. Такими аналогами являются одноцепочечные антитела, представляющие собой небольшие полипептиды (около 26 кДа), в которых вариабельные домены тяжелой (Vh) и легкой (Vl) цепей иммуноглобулина объединены гибким пептидным линкером в единую молекулу. Поскольку такие антитела представляют собой анти-генсвязывающий домен исходного иммуноглобулина, они, как правило, сохраняют специфичность и обладают сходным сродством к антигену [6].
Цель данной работы заключалась в получении одноцепочечного антитела против вируса КЭ и оценке его аффинности.
Материалы и методы
Материалы. В качестве антигена в работе использовали инактивированный вирус клещевого энцефалита и рекомбинантный белок Е вируса КЭ [7].
Эндонуклеазы рестрикции, Taq-полимераза, Pfu-полимераза, ДНК-лигаза фага Т4 («Сибэнзим», Россия).
Бактериальные штаммы: E. coli DH5aF/
(F-, q& gt-80dlacZAM15, recAl, endAl, gyrA96, thi-1, hsdR17(rk, m+), supE44, relAl, deoR) A (lacZYA-argF)U169- E coli bL21 (DE3) (F-, ompT, hsd Sb (rb-, mb-), gal dcm (DE3)).
Выделение РНК проводили с помощью TRIzol-реагента («Sigma», США). Для этого к 200 мкл клеточной суспензии (5−10×106 клеток/мл) добавляли 1 мл TRIzol-реагента и перемешивали в течение 30 мин при 30 °C. Затем к лизату добавляли 100 мкл хлороформа, интенсивно встряхивали и в течение 20 мин инкубировали при 70 °C, после чего суспензию центрифугировали в течение 15 мин при 12 000 х g. Верхнюю водную фазу объединяли с 5 мкл 10% декстрана, к полученному раствору добавляли 600 мкл изопропанола, перемешивали и выдерживали 30 мин при — 20 °C, после чего смесь центрифугировали 30 мин при 12 000 х g, отбирали водную фазу, из которой РНК осаждали этанолом.
Синтез кДНК и амплификацию генов, кодирующих вариабельные домены тяжелой и легкой цепей иммуноглобулина мыши, проводили методом ОТ-ПЦР с использованием коммерческого набора Titan one tube RT-PCR («Roche Applied Science», Германия) согласно инструкции производителя. Для синтеза фрагмента ДНК, кодирующего вариабельный домен тяжелой цепи, в реакционную смесь добавляли праймер Vhdir
5/-CGGAACTCGAGGTMMAGCTGSAGTC, соответ-
ствующий последовательности мРНК, кодирующей FR1-районы тяжелых цепей иммуноглобулинов мыши и Vhrev 5/-TGAGGAGACGGTGACCGTGGTGCCTTGG CCCCA, комплементарный J-сегментам тяжелых цепей иммуноглобулинов мыши. Праймеры Vhdir и Vhrev содержат в своем составе сайты узнавания для эндонуклеаз рестрикции XhoI и BstEII, соответственно.нтез фрагмента ДНК, кодирующего вариабельный домен легкой цепи, проводили с использованием вырожденного праймера Vldir 5/-GAYATTGAGCTCACMCARWCTMCA, соответствующего последовательности мРНК, кодирующей FRl-районы легких цепей иммуноглобулинов мыши и Vlrev 5/-GGAAGATCTATACAGTTGGTGCAG, комплементарный J-сегментам легких цепей иммуноглобулинов мыши. Праймеры Vldir и Vlrev содержат в своем составе сайты узнавания для эндонуклеаз рестрикции SacI и BglII, соответственно. Продукты амплификации выделяли из ПЦР-смеси с помощью набора QIAquick Gel Extraction Kit («QIAGEN», США) согласно инструкции производителя и анализировали в 1,5% агарозном геле.
Конструирование рекомбинантной плазмидной ДНК pSC10C2. Для получения гена одноцепочечного антитела Vh- и Vl-фрагменты обрабатывали эндонуклеазами рестрикции XhoI, BstEII и SacI, BglII, соответственно, и лигировали с олигонуклеотидным коннектором, кодирующим линкерный пептид (Gly4Ser)3. Коннектор, кодирующий линкерный пептид (Gly4Ser)3 получали отжигом двух пар олигонуклеотидов: '
5/-GTCACCGTCTCCTCAGGTGGCGGTGGCTCGG
GCGGTGGT,
5 / -
GGGTCGGGTGGCGGCGGATCTGACATTGAGCT,
5/-GAGCCACCGCCACCTGAGGAGACG,
5/-CAATGTCAGATCCGCCGCCACCCGACCCACCA
CCGCC.
Фрагмент ДНК, кодирующий лидерный пептид пектатлиазы B (pelB), был получен методом ПЦР с использованием в качестве матрицы плазмиды pET (rF11) и олигонуклеотидных праймеров 5/-CCGCTCGAGCAGCTGCACCTGGGC, 5/GGAATTCGACCACACTCCCCTTG, обеспечивающих в амплификационном фрагменте сайты узнавания для эндонуклеаз рестрикции EcoRI и XhoI. Этот фрагмент, обработанный эндонуклеазами рестрикции EcoRI и XhoI, и ген одноцепочечного антитела, обработанный эндонуклеазами рестрикции XhoI и BglII, были встроены в плазмиду pGEM1 по сайтам рестрикции EcoRI и BglII. Полученную в результате плазмиду pSC10C2 анализировали с помощью эндонуклеаз рестрикции EcoRI, XhoI, BstEII, SacI, BglII. Структуру гена одноцепочечного антитела подтверждали секвенированием. Секвенирование проводили с использованием автоматического секвенатора CEQTM 2000XL DNA Analysis System («Beckman coulter» USA) и наборов CEQTM DTCS Quick Start Kit («Beckman coulter» USA).
Получение одноцепочечного антитела в клетках E. coli. Для получения одноцепочечного антитела использовали штамм E. coli BL21(DE3). Культуру клеток трансформировали плазмидной ДНК pSCl0С2. Индивидуальный клон после трансформации трижды рассевали до отдельных колоний. Рекомбинантный штамм нарабатывали в питательной среде 2xYT, содержащей 100 мкг/мл ампицилина, инкубировали до оптической плотности 0,6−0,8 при 37 °C и интенсивном качании, после чего клетки индуцировали 1 мМ IPTG в течение 15 ч.
Получение субклеточных фракций E. coli. Для
фракционирования клеток E. coli индуцированную культуру центрифугировали в течение 5 мин при 10 000 х g. Образовавшийся осадок ресуспендировали в буфере STE (200 мМ Трис-HCl, pH 8,0, 10 мМ ЭДТА, 20% сахароза) и выдерживали 30 мин во льду. Полученную суспензию клеток центрифугировали в течение 10 мин
при 10 000 х g- супернатант представлял собой фракцию периплазматических белков. Образовавшийся осадок клеток ресуспендировали в буфере TE (50 мМ Трис-HCl, pH 8,0, 10 мМ ЭДТА), после чего клетки разрушали с помощью ультразвукового дезинтегратора Ultrasonic Processor («Cole Parmer Instruments», США), как описано в протоколе [8]. Полученную суспензию клеток центрифугировали в течение 10 мин при 10 000 х g- супернатант представлял собой фракцию цитоплазматических белков.
Очистка одноцепочечного антитела с помощью гель-фильтрации. Раствор периплазматических белков объемом 2 мл, содержащий одноцепочечное антитело, наносили на хроматографическую колонку (длина 80 см, диаметр 1,4 см), с сорбентом сефакрил S-300 («Pharmacia», Швеция) и уравновешенную буфером, содержащим 10 мМ Трис-HCl, pH 7,6- 0,1 M NaCl. На выходе из колонки располагали спектрофотометрический детектор, за которым следовал коллектор фракций. Оптическую плотность элюата на выходе из колонки регистрировали при Х=280 нм. Как только фронт достигал выхода колонки, начинали собирать фракции объемом 2 мл. Состав фракций анализировали методом электрофореза в 12% ПААГ с SDS [9]. Фракции, содержащие одноцепочечное антитело, объединяли и осаждали сульфатом аммония (65% от насыщения). Осадок растворяли и проводили диализ против 0,9% раствора NaCl. Концентрацию очищенного одноцепочечного антитела измеряли на спектрофотометре SmartSpecTM 3000 («Bio Rad», USA), используя метод Лоури-Фолина [10].
Иммуноблотинг. Рекомбинантный белок Е вируса КЭ разделяли электрофоретически в 12% ПААГ с SDS и переносили на нитроцеллюлозную мембрану 0,45 мкм («Millipore», США). После блокирования сайтов неспецифического связывания 3% раствором бычьего сывороточного альбумина (БСА) («Sigma», США) мембрану инкубировали с очищенным одноцепочечным антителом в концентрации 19,6 нг. Связавшееся антитело выявляли при добавлении конъюгата щелочной фосфатазы с антивидовыми антителами в разведении 1: 1000. Визуализацию иммунного комплекса проводили, добавляя 5-бромо-3-индолофосфат («Carl Roth GmBh», Германия) и нитротетразолевый синий («Sigma», США).
Иммуноферментный анализ. Одноцепочечное антитело в составе клеточных лизатов тестировали с использованием инактивированного вируса КЭ. На поверхность полистиролового планшета сорбировали инактивированный вирусный препарат (вирус КЭ, штамм 205), в концентрации 200 нг/лунку и после блокировки мест неспецифического связывания 3% раствором БСА инкубировали с последовательными разведениями клеточных лизатов, содержащих одноцепочечное антитело. Иммунные комплексы выявляли добавлением антивидового конъюгата щелочной фосфатазы в разведении 1: 1000. В качестве хромогена использовали пара-нитрофенилфосфат («ICN», США). В качестве отрицательного контроля использовали лизаты клеток, несущих векторную плазмиду pGEM1.
Определение константы аффинности одноцепочечных антител. Очищенное одноцепочечное антитело 10C2 в концентрации 2,0×10−8 М инкубировали с последовательными разведениями рекомбинантного белка Е в концентрации от 1,2×10−6 М до 9,3×10−9 М. Полученные растворы добавляли в лунки с предварительно сорбированным рекомбинантным белком Е в концентрации 200 нг/лунку. Иммунные комплексы выявляли при добавлении антивидового конъюгата щелочной фосфата-зы в разведении 1: 1000. В качестве хромогена использовали пара-нитрофенилфосфат.
Результаты и обсуждение
Для конструирования одноцепочечного антитела к вирусу КЭ в качестве прототипа было использова-
но МКА 10С2, продуцируемое мышиной гибридомой. Выбор этой гибридомы был обусловлен тем, что по данным конкурентного анализа МКА 10С2 взаимодействует с доменом Е2 гликопротеина Е, согласно классификации Цехановской с соавторами [11]. Известно, что домен Е2 играет основную роль в формировании нейтрализующих и протективных антител, а также участвует в рецепторном связывании. Было показано, что МКА 10С2 способно защищать модельных животных от вирусной инфекции в реакции биологической нейтрализации, а также способно блокировать гемагглютини-рующую активность вируса [11].
На первом этапе работы из клеток гибридомы 10С2 выделили суммарную РНК. Синтез кДНК и амплификацию генов, кодирующих вариабельные домены тяжелой и легкой цепей иммуноглобулина мыши, проводили методом ОТ-ПЦР. Определение нуклеотидных последовательностей ПЦР-фрагментов, кодирующих УЬ- и У1-цепи МКА 10С2, показало, что УЬ-сегмент принадлежит к семейству УЩ558. 45 тяжелых цепей антител мыши, а У1-сегмент принадлежит к генам к-цепей. На рис. 1 приведены аминокислотные последовательности вариабельных доменов тяжелой (УЬ) и легкой (VI) цепей антитела 10С2 в сравнении с УЬ- и У1-цепями МКА 4.2 и МКА Е6 В. Известно, что антитело 4.2 способно нейтрализовать вирус шотландского энцефалита овец, который по современной классификации относится к роду Flavivirus [12]. Подобные свойства в отношении вируса КЭ для антитела Е6 В не были показаны [13, 14]. Из данного сравнения видно, что антитело 10С2 не имеет общих мотивов в CDR-участках (ответственных за связывание с антигеном) с антителами 4.2 и Е6 В. Исходя из этого, можно предположить, что данное антитело, обладающее уникальной молекулярной структурой, будет иметь свойства, отличающиеся от свойств сравниваемых антител.
Vh-цепи
CDR-1
10С2 EVKL. EES VPELVKPGAS VKLSCKSSGYTFTENTIHV7VKQSHGKSLEY IG
4.2 Q.Q. QQ. G…М. .А… DYV.Q.. RT. QG. .W..
ЕбВ VEL.. SGGGL. .Q. .Е.М.. . VA. .F.: DAWMD. L.. PE.G.. WVA
CDR-2
10С2 GINPDNGGTSYNQKTKQK--ATLTVDKSSSTAYMELRSLTSEDSAVYYC
4.2 E.Y. OS.T.Y. .В… D .-.. .A…N. …Q.S…F.
Е6 В В. RSKSNNHATSYAESVEGRF. ISR.D.К. SV. LQMNN. RA. TGI…
CDR-3
10С2 ARWEITA-TbAYWGQGTLVTVSS
4.2. .G. DEYYIA. D…Т…
Е6 В Т. YYOYX. YWYFDVL.. .Т.
VI-цепи
CDR-1
10С2 DIELTQS РА-LMSASPGEKVTMTCSASSSVS-YMF-----------WYQQKPRSSP
4.2 -SL. .V. .T.I. R.. GNXHN. LA… QGK..
ЕбВ … PPSLAV. L. QGA. IS .R. .К. LDS. GNSFLH. LGQP.
10С2 KSWIYLTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSS
4. 2 ОІіЬУ. КА ОТ.. О.. .Б. <-2. .K.N. LQP. ГвБ … НГМ.
ЕбВ. іііі.. .А. .В.. I*.И. ОРТ.. БРV.. О… NN0
CDR-3
10С2 -PL-TFGGGTKLEIKRA
4.2 Т. PH…
ЕбВ Р. -.. Б…
Рис. 1. Сравнение аминокислотных последовательностей вариабельных доменов тяжелых (УЬ) и легких (VI) цепей моноклональных антител 10С2, 4.2 и Е6 В.
На следующем этапе ДНК-фрагменты, кодирующие УЬ- и У1-домены МКА 10С2, объединяли с помощью олигонуклеотида, кодирующего линкерный пептид ^1у48ег)3. Полученный ген одноцепочечного антитела встраивали в плазмиду pGEM1 под транскрипционный контроль позднего промотора бактериофага Т7. К 5'--концу гена, кодирующего одноцепочечное антитело 10С2 (зс10С2), был присоединен фрагмент ДНК, кодирующий лидерный пептид пектатлиазы В (реІВ) Erwinia carotovora, полученный на основе плазмиды рЕТ (^11) [15] с использованием ПЦР. Известно, что лидерные пептиды эффективно секретируемых прокариотиче-
ских белков, таких как ре1 В, направляя секрецию в пе-риплазматическое пространство, способствуют правильной упаковке молекул одноцепочечных антител. Считается, что секреция белка в периплазму бактерий имитирует его транспорт через эндоплазматический ретикулум в эукариотических клетках [16]. В результате была получена рекомбинантная плазмида р8С10С2 (рис. 2). Правильность встраивания ДНК-фрагментов подтверждали секвенированием.
Рис. 2. Схема строения рекомбинантной плазмиды pSC10C2. Указаны сайты эндонуклеаз рестрикции. Т7 — поздний промотор фага Т7- pelB — фрагмент ДНК, кодирующий лидерный пептид- Vh и VI- вариабельные участки генов, кодирующих тяжелую и легкую цепь рекомбинантного антитела- linker (Gly4Ser)3 — фрагмент ДНК, кодирующий линкерный пептид- Apr — ген устойчивости к ампициллину.
Сконструированной плазмидой pSC10C2 трансформировали клетки E. coli BL21(DE3), содержащие в бактериальной хромосоме ген РНК-полимеразы фага Т7 под контролем индуцибельного промотора lacUV5. При добавлении в культуральную среду индуктора lac-оперона IPTG в этом штамме синтезируется РНК-полимераза фага Т7, обеспечивающая высокоэффективную транскрипцию со специфических промоторов. Клетки E. coli BL21(DE3)/pSCl0C2 индуцировали IPTG в среднелогарифмической стадии роста и культивировали в течение ночи. Электрофоретический анализ лизатов клеток E. coli BL21(DE3)/pSC10C2 показал наличие в индуцированной культуре дополнительного белка с молекулярной массой около 26 кДа, что соответствует расчетной молекулярной массе одноцепочечного антитела (рис. 3, дорожка 2). В контрольном лизате индуцированных клеток, содержащих плазмиду без встройки, этот белок отсутствовал (рис. 3, дорожка 1).
Способность полученного одноцепочечного антитела связывать вирус КЭ была подтверждена методом иммуноферментного анализа (ИФА) взаимодействия клеточных лизатов, содержащих одноцепочечное антитело, с вирусом КЭ, сорбированным на поверхность иммунологического пластика. Результаты показали, что значение оптической плотности при связывании с вирусом одноцепочечного антитела, достоверно превышает таковое в контроле, что доказывает способность sc10C2 эффективно связываться с вирусом КЭ (рис. 4).
Исследование внутриклеточной локализации sc10C2 показало, что одноцепочечное антитело секре-тировались в периплазматическое пространство (рис.
3, дорожка 4). Очистку одноцепочечного антитела из периплазмы проводили методом гель-фильтрации. Результаты приведены на рис. 3 (дорожка 7). Анализ
кДа
18
7
___________М 1 2 3 4 5 6 7
Рис. 3. Электрофореграмма в 12% 8Б8-ПААГ лизатов клеток, периплазматических и цитоплазматических фракций, а также очищенных одноцепочечных антител. Дорожки: лизаты клеток Е. соИ ВЬ21 (DE3)/pGEM1 (1), Е. соИ ВЬ21 (ББ3)/р8С10С2 (2) — периплазма-тические фракции клеток Е. соИ ВЬ21 (DE3)/pGEM1 (3), Е. соИ ВЬ21 ^Е3)/р8С10С2 (4) — цитоплазматические фракции клеток Е. соИ ВЬ21 (DE3)/pGEM1 (5), Е. соИ ВЬ21 (DE3)/pSC10С2 (6) — очищенные зс10С2 (7) — М — стандарт молекулярных масс.
1/10 1/20 1/40 1/80 1/160 1/640 1/2560
Разведения клеточных лизатов
Рис. 4. Иммуноферментный анализ взаимодействия клеточных лизатов, содержащих эс10С2, с инактивированным вирусом КЭ, штамм 205. Клеточные лизаты нанесены в последовательных разведениях- проявление антивидовым конъюгатом щелочной фосфатазы в разведении 1/1000.
геля с помощью программы «Ое1-Рго» показал, что уровень очистки составил приблизительно 70%.
Специфичность очищенного 8с10С2 подтверждали с помощью иммуноблот-анализа (рис. 5). Было показано, что одноцепочечное антитело выявляло рекомбинантный белок Е вируса КЭ. В качестве положительного контроля использовали исходное МКА 10С2. В качестве отрицательного контроля использовали нормальную неиммунную мышиную сыворотку (рис. 5).
На следующем этапе с помощью иммуноферментно-го анализа [17] была определена константа аффинности полученного антитела. Для регрессии экспериментальных данных использовали следующую зависимость:
OD405(в0) = Ж ¦ (А0-в0 -Kd + УК + B0+Kd)2- 4 ¦ A0 ¦ B
где OD405 —
оптическая плотность раствора в лунке планшета, Ао — суммарная концентрация антитела в растворе (на стадии первоначальной инкубации),
В0 — суммарная концентрация белка Е, Kd — константа равновесия диссоциации комплекса антиген-антитело в растворе, N- нормировочный множитель, который определяется параметрами эксперимента и не зависит от концентрации антител. Регрессию осуществляли с использованием математического пакета Origin® 7.0. График зависимости значения оптической плотности раствора от концентрации антитела приведен на рис. 6. Константа аффинности для sc10C2 составила (1,2 ± 0,3) х 107 М-1.
Таким образом, на основе генетического материала гибридомы 10С2, продуцирующей МКА против вируса КЭ, сконструирована рекомбинантная плазмидная ДНК pSC10C2, обеспечивающая экспрессию одноцепочечного антитела в клетках E. coli BL21(DE3). Полученное одноцепочечное антитело в составе клеточных лизатов способно эффективно связываться с вирусом КЭ, штамм 205. После хроматографической очистки sc10C2 была измерена константа аффинности полученного антитела, которая составила (1,2 ± 0,3) х 107 М-1. Учитывая тот факт, что одноцепочечное антитело имеет только
Рис. 5. Электрофореграмма в 12% SDS-ПААГ рекомбинантного белка Е вируса КЭ (1) и иммуноблот-анализ этого белка с использованием очищенных 8с10С2 (2), МКА 10С2 (3), а также нормальной неиммунной мышиной сыворотки (4) — М — стандарт молекулярных масс.
Рис. б. Иммуноферментный анализ взаимодействия очищенных sc10C2 с рекомбинантным белком Е вируса КЭ в растворе- проявление антивидовым конъюгатом щелочной фосфатазы в разведении 1/1000.
один антигенсвязывающий сайт, можно предположить, что сконструированное на его основе химерное антитело будет обладать аффинностью на 1−2 порядка выше и в случае наличия нейтрализующих и протективных свойств данное антитело могло бы стать ценным препаратом для профилактики и терапии клещевого энцефалита.
На основе кДНК-фрагментов генов, кодирующих вариабельные домены тяжелой и легкой цепей MКA 10С2 против гликопротеина Е вируса КЭ, сконструирована рекомбинантная плазмидная ДНК pSC10C2, обеспечивающая экспрессию одноцепочечного антитела sc10C2 против вируса КЭ в клетках Escherichia coli. Полученное антитело sc10C2 связывало вирус КЭ, штамм 205, и рекомбинантный белок Е вируса КЭ- константа аффинности sc10C2 составила (1,2 ±
0, З) x 107 М-1.
Авторы выражают глубокую благодарность Е. В. Протопоповой и А. Б. Рыжикову (ФГУН ГНЦ ВБ «Вектор») за плодотворное обсуждение полученных результатов.
Работа была частично поддержана администрацией Новосибирской области, проект ДН-01−06.
ЛИТЕРАТУРА
1. Беспалов И. А., Шиянов П. А., Лукашевич Л. В. Получение одноцепочечных антител к ферритину человека в клетках Escherichia coli // Молекулярная биология. — 1993. — № 27. — С. 451−460.
2. Гловер Д. Новое в клонировании ДНК. — М.: Мир, 1989. — 222с.
3. Досон Р., Элиот Д., Элиот У., Джонс К. Справочник биохимика. — М.: Мир, 1991. — 466 с.
4. Злобин В. И. Клещевой энцефалит в Российской Федерации: современное состояние проблемы и стратегия профилактики // Вопросы вирусологии. — 2005. — № 3. — С. 26−32.
5. Локтев В. Б., Терновой В. А., Нетесов С. В. Молекулярно-генетическая характеристика вируса клещевого энцефалита // Вопросы вирусологии. — 2007. — № 5. — С. 6−10.
6. Николенко Г. Н., Протопопова Е. В., Ильичев А. А. и др. Рекомбинантные антитела к вирусу клещевого энцефалита // Вопросы вирусологии. — 2002. — Т. 47. — № 5. — С. 31−36.
7. Рекомбинантная плазмидная ДНК PGSDEI, кодирующая белок Е вируса клещевого энцефалита и штамм Escherichia coli — продуцент рекомбинантного белка Е вируса клещевого энцефалита: Патент Р Ф № 2 136 754, Н.А., 1999.
8. Ройт А., Бростофф Дж., Мейл Д. Иммунология. — М.: Мир, 2000. — 97с.
9. Тикунова Н. В., Николенко Г. В., Протопопова Е. В. и др. Получение одноцепочечных антител к поверхностному гликопротеину E вируса клещевого энцефалита // Вопросы вирусологии. — 1999. — Т. 44. — № 1. — С. 12−15.
10. Bird R.E., Hardman K.D., Jacobson J.W. Single-chain antigen-binding proteins // Science. — 1988. — Vol. 242. — P. 423−426.
11. Friguet B., Chaffotte A.F., Djavadi-Ohaniance L., Goldberg M.E. Measurements of the true affinity constants in solution of antigen-antibody compexes by enzyme-linked immunosorbent assay // Journal of Immunological Methods. — 1985. — Vol. 77. — P. 305−319.
12. Jiang W, Bonnert T.P., Venugopal K., Gould E.A. A single chain antibody fragment expressed in bacteria neutralizes tick-borne flaviviruses // Virology. — 1994. — Vol. 200. — P. 21−28.
13. Laemmli U.K. Cleavage of structural proteins during the assembly of the head of bacteriophage T4 // Nature. — 1970. — Vol. 227. — P. 680−685.
14. Presta L.G. Engineering of therapeutic antibodies to minimize immunogenicity and optimize function // Advanced Drug Delivery Reviews. — 2006. — Vol. 58. — P. 640−656.
15. Scerra A., Pluckthun A. Assembly of a functional
immunoglobulin Fv fragment in Escherichia coli // Science. — 1988. — Vol. 240. — P. 1038−1041.
16. Tsekhanovskaya N.A., Matveev L.E., Rubin S.G. et al. Epitope analysis of tick-borne encephalitis (TBE) complex viruses using monoclonal antibodies to envelope glycoprotein of TBE virus (persulcatus subtype) // Virus Research. — 1993. — Vol. 30. — P. 1−16.
17. Xie L., Jones R.M., Glass T.R., et al. Measurement of the functional affinity constant of a monoclonal antibody for cell surface receptors using kinetic exclusion fluorescence immunoassay // Journal of Immunological Methods. — 2005. — Vol. 304. — P. 1−14.
Адрес для переписки: Леванов Лев Николаевич — младший научный сотрудник лаборатории разработки средств экстренной профилактики ФГУН ГНЦ ВБ «Вектор» (630 559 Новосибирская область, пос. Кольцово). Телефон: 8(383) 336−58−95- - младший научный сотрудник лаборатории молекулярной иммунологии Института химической биологии и фундаментальной медицины СО РАН,
630 090, город Новосибирск, проспект Лаврентьева, 8. E-mail: levanov_lev@mail. ru
© ШПЫНОВ С.Н., АРСЕНЬЕВА И.В., ГРАНИТОВ Н.В., РУДАКОВ В.М. — 2008
КЛЕЩЕВОЙ РИККЕТСИОЗ В АЛТАЙСКОМ КРАЕ: ЭПИДЕМИОЛОГИЧЕСКИЕ АСПЕКТЫ, МОЛЕКУЛЯРНО-БИОЛОГИЧЕСКАЯ ВЕРИФИКАЦИЯ
С. Н. Шпынов, И. В. Арсеньева, В. М. Гранитов, Н. В. Рудаков (Алтайский государственный медицинский университет, Барнаул-
Омская государственная медицинская академия- Омский НИИ природноочаговых инфекций)
Резюме. Последние десятилетия XX века характеризуются ростом заболеваемости природно-очаговыми инфекциями, передаваемыми клещами, в том числе клещевым риккетсиозом (сибирский клещевой тиф или клещевой сыпной тиф Северной Азии). Начиная с 1936 г. (начало официальной регистрации клещевого риккетсиоза) по 2007 г. в России зарегистрировано более 68 тысяч случаев этой инфекции. Наиболее существенный рост заболеваемости отмечен в Западной Сибири и на Дальнем Востоке. При этом эпидемическую ситуацию по клещевому риккетсио-зу в Западно-Сибирском регионе определяет Алтайский край и Республика Алтай (показатель заболеваемости на 100 тыс. населения — более 50,0). Заболеваемость клещевым риккетсиозом зарегистрирована во всех ландшафтногеографических зонах Алтайского края. Проведенные молекулярно-биологические исследования позволили выявить «новые» бактериальные патогены из порядка Rickettsiales в переносчиках в очагах клещевого риккетсиоза на территории Алтайского края. Впервые осуществлена молекулярно-биологическая верификация заболеваний у пациентов с клещевым риккетсиозом в Алтайском крае и доказана этиологическая роль R. sibirica sensu stricto в возникновении заболеваний этой инфекцией.
Ключевые слова: клещевой риккетсиоз, верификация.
TICK-BORNE RICKETTSIOSIS IN ALTAI REGION: EPYDEMIOLOGICAL ASPECTS, MOLECULO-BIOLOGICAL VERIFICATION
S.N. Shpynov, I. V Arsenjeva V.M., Granitov, N.V. Rudakov (Altai State Medical University, Barnaul, Omsk State Medical Academy, Omsk Research Institute of Natural Foci Infections, Russia)
Summary. The last decades of the XX th century are characterized by the growth of the morbidity rate caused by natural-foci infections passed by the tiks, including tick-borne rickettsiosis (Siberian tick typhus or tick-borne spotted fever typhus of North Asia). From 1936 (the beginning of the official registration of the tick-borne rickettsiosis) to 2007, 68 thousand cases of this infection are registered in Russia. The most essential growth of the sickness rate is registered in West Siberia and Far East. In this case Altai region and the Republic of Altai (the ratio of the sickness rate is 50,0 persons per 100 thousand of the population) define the epidemiological situation on the tick-borne rickettsiosis on the territory of the Western-Siberian region. The sickness rate of the tick-borne rickettsiosis is registered in all geographical landscapes of Altai region. The carried-out moleculo-biological studies have allowed to reveal «new» bacterial pathogens out of the Rickettsiales in the vectors in the tick-borne rickettsiosis centers on the territory of Altai region. The moleculo-biological verification of the diseases among the patients having the tick-borne rickettsiosis was realized in Altai region for the first time and the etiological role of R sibirica sensu stricto in the origination of this infection diseases was proved.
Key words: tick-borne rickettsiosis, verification.
Клещевой риккетсиоз (КР) (сибирский клещевой тиф или клещевой сыпной тиф Северной Азии) — природноочаговая облигатно-трансмиссивная инфекция, вызываемая Rickettsia sibirica, эпидемически активные очаги которой имеют распространение в Азиатской части России. Эта инфекция зарегистрирована на 18 административных территориях юга Сибири и Дальнего Востока. С начала регистрации заболеваний КР в 1936 г. по 2007 г. (включительно) в России зарегистрировано более 68 тысяч случаев этой инфекции.
Официальная регистрация КР в Алтайском крае и республике Алтай (ранее — единая административ-
ная единица) ведется с 1942 г. За 65 лет исследований (1942 — 2007 гг.) в Алтайском крае (до 1995 г. республика Алтай включительно) было зарегистрировано 27 877 случаев КР из них 10 985 случаев (39,4%) — за последнее десятилетие (1998 — 2007 гг.).
В последние десятилетия описан ряд «новых» патогенов человека из порядка РккеШ1а1в5 (Лпар1а$та phagocytophila и Я. heilongjiangensis), вызывающих заболевания сходные по клинической картине с КР.
Цели настоящего исследования — анализ эпидемиологических особенностей КР в Алтайском крае (динамика, сезонность, клинико-серологические дан-

ПоказатьСвернуть
Заполнить форму текущей работой