Материалы 56-го конгресса Американского гематологического общества (декабрь 2014 г., Сан-Франциско)

Тип работы:
Реферат
Предмет:
Медицина


Узнать стоимость

Детальная информация о работе

Выдержка из работы

Клин. онкогематол. 2015- 8(2): 201−232 Klin. Onkogematol. 2015- 8(2): 201−232
^^^^^ Ы I клиническая ^^^^^ ^^^с I i n i с, а I
Шя иж1^ Шш W ^^
ГЕМАТОЛОГИЯ HEMATOLOGY
СЪЕЗДЫ, КОНФЕРЕНЦИИ, CONGRESSES, CONFERENCES,
СИМПОЗИУМЫ SYMPOSIA
Материалы 56-го конгресса Американского гематологического общества
(декабрь 2014 г., Сан-Франциско)
С 6 по 9 декабря 2014 г. состоялся 56-й конгресс Американского гематологического общества (American Society of Hematology, ASH) в г. Сан-Франциско (США). Ниже приводится краткое изложение некоторых сообщений, доложенных на конгрессе.
КЛАССИЧЕСКИЕ РЬ-НЕГАТИВНЫЕ МИЕЛОПРОЛИФЕРАТИВНЫЕ НЕОПЛАЗИИ
Подготовили д-р мед. наук А. Л. Меликян и канд. мед. наук И.Н. Суборцева
введение
За 10 лет со времени открытия мутации JAK2 V617 °F у больных с классическими Ph-негативными миелопро-лиферативными неоплазиями (МПН) произошли значительные изменения в диагностике и лечении истинной полицитемии (ИП), эссенциальной тромбоцитемии (ЭТ), первичного миелофиброза (ПМФ). Связано это с пониманием патогенеза данной группы заболеваний. Разработан, прошел клинические исследования, был одобрен Управлением по контролю за качеством пищевых продуктов и лекарственных средств США (FDA) и зарегистрирован для лечения больных миелофиброзом JAK1/ ЛАК2-ингибитор руксолитиниб. Несмотря на достижения последнего десятилетия, остается много нерешенных вопросов.
На 56-м конгрессе Американского общества гематологов (ASH) были представлены достижения, касающиеся молекулярного патогенеза, оценки факторов риска и прогнозирования течения заболевания, ответа на терапию, алгоритмов ведения больных ИП, ЭТ, ПМФ, клинических исследований и перспектив лечения больных с классическими Ph-негативными МПН.
молекулярный патогенез
В последнее десятилетие достигнуты определенные успехи в понимании молекулярного патогенеза РИ-негативных МПН. Были открыты специфические молекулярные аномалии, характерные для ИП, ЭТ и ПМФ. Прежде всего, это мутации гена 1АК2, а также мутации гена рецептора тромбопоэтина (МРЬ) и гена калретикулина (САЬЯ). На современном этапе диагностики у 90% больных МПН возможно выявление молекулярного маркера, что позволяет говорить о клональной природе заболеваний.
В патогенезе МПН центральное место занимает активация сигнального пути ЛАК-ЗТАТ. В норме функция ЛАК-киназ заключается в том, что они служат промежуточным звеном между рецепторами на мембране клетки и сигнальными внутриклеточными молекулами. При взаимодействии с определенными рецепторами их лигандов (эритропоэтином, колониестимулирующими факторами, интерлейкинами и др.) возникает такое изменение конформации рецепторов, что происходит ауто-фосфорилирование ЛАК-киназ. Далее активированная киназа фосфорилирует целый ряд белков, которые передают сигналы к ядру, направленные на активацию
201
© 2015 практическая медицина
Рис. 1. Механизмы передачи сигнала от JAK-киназы в ядро клетки [E. Chen, A. Mullally. How does JAK2V617 °F contribute to the pathogenesis of MPN? Hematology. 2014. Educational program. pp. 268−76]
La — аутоантиген- OSM — онкостатин M- PRMT — N-метилтрансфераза аргининов белка- Р — фосфорилированный белок.
Fig. 1. Mechanisms of transduction of signal from JAK-kinase into the cell nucleus [E. Chen, A. Mullally. How does JAK2V617 °F contribute to the pathogenesis of MPN? Hematology. 2014. Educational program. pp. 268−76]
La — autoantigen- OSM — oncostatin M- PRMT — protein arginine N-methyltransferase- P — phosphorylated protein.
пролиферации и дифференцировки, угнетение апоптоза клеток-предшественниц.
При появлении соматической мутации, которая заключается в замене гуанина на тимин в положении 1849 экзона 14 на коротком плече хромосомы 9р24, что ведет к замене валина на фенилаланин в кодоне 617 полипептидной цепи JAK2, наблюдается постоянная активация JAK2 вне зависимости от связывания цитокинового рецептора со своим лигандом. Передача сигнала внутри клетки представляет собой цепь последовательных биохимических реакций, осуществляемых вторичными посредниками: PIM-киназы (PIM½) стимулируют пролиферацию, угнетают апоптоз- MYC и JUNB обеспечивают активацию пролиферативного ответа- циклин D2, p27KIP, CDC25A принимают участие в регуляции клеточного цикла, активируют переход от G1-фазы к S-фазе- PU.1 и ID1 активируют дифференцировку- BCL-xL и MCL-1 ингибируют апоптоз, обеспечивают независимый от цитокина и эритропоэтина рост колоний- RAD51 приводит к геномной нестабильности.
Регуляция дифференцировки и пролиферации, угнетение апоптоза, контроль репарации осуществляются и за счет эпигенетических механизмов, которые не затрагивают первичную структуру ДНК, а изменяют активность определенных генов (рис. 1).
В 2013 г. двумя группами ученых независимо [T. Nan-galia et al. N. Engl. J. Med. 2013- 369(25): 2391−405- T. Lamphet et al. N. Engl. J. Med. 2013- 369(25): 2379−90] выявлена мутация в экзоне 9 гена CALR. Белок, кодируемый
данным геном, локализован в эндоплазматическои сети. С-концевой фрагмент несет на себе отрицательный заряд и способен связывать кальций, тем самым являясь его буфером. Известно, что кальций играет жизненно важную роль в функционировании и выживании клеток. Например, он служит ключевым элементом при передаче внутриклеточных и внеклеточных сигналов. Инициация клеточных ответов на факторы роста, нейромедиаторы, гормоны и множество других сигнальных молекул происходит посредством кальций-зависимых процессов. Практически все типы клеток зависят от генерирования цитоплазматических кальций-зависимых сигналов для регуляции функционирования клеток или для запуска определенных ответов. Таким образом, белок, кодируемый геном CALR, способен оказывать влияние на активность сигнальных путей STAT. В настоящее время известно о существовании 36 мутаций данного гена (рис. 2). Открытие мутаций гена CALR имеет важное диагностическое и прогностическое значение. Так, пациенты с мутацией CALR, имеют благоприятный прогноз в сравнении с больными с JAK2- или MPL-мутациями.
Изучение механизмов регуляции экспрессии генов также остается одним из главных направлений исследований при МПН. Изменения экспрессии генов клетки, не затрагивающие последовательность ДНК, происходят за счет ряда механизмов: метилирование ДНК, модификации гистонов, ремоделирование хроматина, микроРНК (mRNA). Сплайсинг mRNA представляет собой процесс вырезания определенных нуклеотидных последователь-
202
Клиническая онкогематология
А
Тип 1- L367fs*46
(делеция 52 п. н.) Тип 2- K385fs*47 (вставка 5 п. н.)
Частые варианты (85%)
3'--UTR
Редкие варианты (15%)
CGTTTA
Б
CCTCCTCTTTGTCT CCATCCTTGTC TCCTTGTC TGTC TCTTGTC CTTGTC TGTGTC TTTGTC ATGTC GTGTC TGTCG
Дикий тип
QDEEQRLKEEEE DKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Тип 1- L367fs*46 QDEE… QRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA
NS
Тип 2- K385fs*47 QDEEQRLKEE EEDKKRKEEE EAEDRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA
Новая пептидная последовательность
В
P-домен
N-домен
Мутация CALR
в экзоне 9 ->
C-домен KDEL
P-домен N-домен
C-домен
Рис. 2. (Л) Мутации гена CALR в экзоне 9, выявляемые с наибольшей частотой: тип 1 (делеция 52 п. н.), тип 2 (вставка 5 п. н.). (Б) Аминокислотная последовательность: дикий тип — норма, типы 1 и 2 — наиболее часто встречающиеся мутации. (В) Изменение функции белка в результате мутации гена CALR [J. Nangalia, T.R. Green. The involving genomic landscape of myeloproliferative neoplasms. Hematology. 2014. Educational program. рр. 287−96] п. н. — пара нуклеотидов- UTR — нетранслируемая область.
Fig. 2. (Л) Most frequently detected CALR exon 9 gene mutations: type 1 (52 bp deletion), type 2 (5 bp insertion). (Б) Amino acid sequence: wild type — normal, type 1, type 2 — most frequently found mutations. (В) Changes in protein functions due to CALR gene mutations [J. Nangalia, T.R. Green. The involving genomic landscape of myeloproliferative neoplasms. Hematology. 2014. Educational program. рр. 287−96] п. н. — base pairs- UTR — untranslated region.
ностей из ее молекулы и соединения последовательностей, сохраняющихся в «зрелой» молекуле, в ходе процессинга шНЫА. Мутации генов — эпигенетических модификаторов, таких как ASXLl, DNMT3a, TET2, EZH2, ЮH1 и IDH2, а также генов, участвующих в сплайсинге шНЫА, таких как SF3B1 и U2AF2, тоже были описаны у больных МПН (табл. 1).
клиника и диагностика
Клиническая картина при МПН характеризуется многообразием проявлений. Начальный период заболевания у
www. medprint. ru
большинства больных ЭТ, ИП, ПМФ может протекать бессимптомно на протяжении ряда лет. Нередко признаки заболевания обнаруживают неожиданно при выполнении клинического анализа крови во время профилактического осмотра или по поводу сопутствующей патологии. Однако зачастую качество жизни больных страдает из-за наличия симптомов опухолевой интоксикации. Исследование качества жизни является относительно новым направлением в медицине и остается практически неизученным у больных МПН. Качество жизни изучают с помощью специально разработанных опросников для выявления интересующих симптомов, установления параметров
203
Таблица 1. Соматические мутации генов у больных с миелопролиферативными неоплазиями Ген Патогенетический механизм ИП, % ЭТ, % ПМФ, % Пост-МПН О Л Прогностическое значение
JAK2 (У617Р) Сигнальный путь МК/БТАТ 95−97 50−60 50−60 50 НД
JAK2 (экзон 12) Сигнальный путь иАК/БТАТ 1−2 0 0 НД НД
CALR Сигнальный путь иАК/БТАТ? Дисфункция эндоплазматического ретикулума? 0 25 30 Н Д Общая выживаемость лучше у больных ПМФ. Низкий риск тромбозов у больных ЭТ
MPL Сигнальный путь иАК/БТАТ 0 3−5 5−10 НД НД
CBL Сигнальный путь иАК/БТАТ НД 0−2 5−10 НД НД
SH2B3/LNK Сигнальный путь иАК/БТАТ 2−20 2−6 3−6 10 НД
ASXL1 Эпигенетическая регуляция 2 5−10 10−35 20 Низкая общая выживаемость и выживаемость без лейкоза у больных ПМФ
EZH2 Эпигенетическая регуляция 1−2 1−2 7−10 Н Д Низкая общая выживаемость и выживаемость без лейкоза у больных ПМФ
ЮШ/2 Эпигенетическая регуляция 2 1 5 10−20 Низкая общая выживаемость и выживаемость без лейкоза у больных ПМФ
DNMT3a Эпигенетическая регуляция 5−10 2−5 8−12 10−15 НД
TET2 Эпигенетическая регуляция 10−20 4−5 10−20 20 НД
SF3B1 Сплайсинг т^А 2 2 4 4 НД
SRSF2 Сплайсинг т^А НД НД 4−7 19−33 Низкая общая выживаемость и выживаемость без лейкоза у больных ПМФ
U2AF1 Сплайсинг т^А & lt- 1 & lt- 1 1−8 НД НД
ZRSR2 Сплайсинг т^А & lt- 1 & lt- 1 & lt- 1 НД НД
TP53 Репарация ДНК 1−2 1−2 1−2 25 Низкая общая выживаемость у больных пост-МПН ОЛ
т^А — микроРНК- ИП — истинная полицитемия- МПН — миелопролиферативные неоплазии- НД — нет данных- ОЛ — острый лейкоз- ПМФ — первичный миелофиброз- ЭТ — эссенциальная тромбоцитемия.
функционирования больного и выяснения его общего состояния. Для оценки симптомов опухолевой интоксикации (конституциональных симптомов) разработаны опросники, такие как MPN-SAF и МРЫ 10. Наиболее частыми жалобами являются утомляемость (87%), нарушение концентрации внимания (62%), чувство раннего насыщения после приема пищи (61%), безразличие (61%), ночная потливость (53%), зуд (53%), дискомфорт в левом подреберье (52%), боль в костях (48%), потеря массы тела (34%), лихорадка (19%). Каждый вариант МПН имеет свои особенности клинических проявлений, что определяется характером заболевания (табл. 2).
Фенотипические признаки заболевания определяются кариотипом и молекулярными характеристиками. Е.А. Wassie и соавт. рассмотрели спектр и распространенность цитогенетических аномалий, а также их связь с фенотипом у 835 больных ПМФ. Цитогенетическое исследование проведено у 826 (99%) из 835 больных. Патология кариотипа выявлена у 352 (42,6%) пациентов, в т. ч. 240 (68,2%) больных имели одну цитогенетическую аномалию, 64 (18,2%) — две и 48 (13,6%) — сложные нарушения кариотипа. При сравнительной характеристике этих групп был выявлен ряд особенностей: более низкий уровень тромбоцитов (р & lt- 0,01), высокий балл по шкале DIPSS+ (р = 0,03), молодой возраст больных (р = 0,04) в группе со сложным кариотипом. Наиболее частыми были 20q- (23,3%), 13ч- (18,2%), +8 (11,1%), +9 (9,9%), удвоение участка хромосомы 1ч (9,7%) и — 7/7ч- (7,1%). Моносомия определялась у 20 (5,7%) пациентов. Другие аномалии: К^) (1,4%), 12р- (1,1%), ту (3) (0,6%) — встречались гораздо реже. Трисомия хромосомы 8 наиболее часто обнаруживалась при комплексных нарушениях кариотипа (25%). Из 500 пациентов, наблюдаемых в течение года после установления первоначального диагноза, у 179 (35,8%) отмечено появление дополнительных аномалий, причем у 121 (67,6%) человека выявлена одна аномалия, у 31
204
Таблица 2. Симптомы миелопролиферативных неоплазий в различных подгруппах
Частота, %
ЭТ ИП ПМФ Всего
Симптом (п = 874) (п = 729) (п = 486) (п = 2089)
Утомляемость 84 85 94 87
Чувство раннего насыщения 56 60 74 61
Дискомфорт в левом подреберье 48 48 65 52
Безразличие 54 60 76 61
Снижение концентрации внимания 58 62 68 62
Ночная потливость 47 52 63 53
Зуд 46 62 52 53
Боль в костях 45 48 53 48
Лихорадка 17 19 24 19
Снижение массы тела 28 33 47 34
(17,3%) — две и у 27 (15,1%) — сложный кариотип. Наиболее распространенными дополнительными нарушениями были 20q- (24,6%), 13ч- (15,1%), +8 (14%) и +9 (10%), тогда как 11ч- (1,7%), ^17ч) (1,1%), ту (3) (0,6%) и 12р- (0,6%) встречались редко.
Молекулярно-генетическое исследование проведено у 476 пациентов. Мутации 1АК2 выявлены в 43% случаев, СА1Я — в 42%, МРЬ — в 3%- 12% наблюдений составили пациенты с тройной негативной МПН (р = 0,3). С мутацией гена САЬ% была связана делеция 13ч (р = 0,03), а трисомия хромосомы 9 — с мутацией гена Ш2 (р = 0,02).
Отмечено, что при сложных нарушениях кариотипа заболевание протекало с анемией (р = 0,02), лейкопенией (р & lt- 0,01) и тромбоцитопенией (р & lt- 0,01), пациенты были молодого возраста (р = 0,04). С лейкопенией и тромбоцитопенией были связаны аномалии 20ч-, +8 и -7/7ч-. Ни у одного больного с 20ч- не было выявлено лейкоцитоза (р = 0,02). В случаях 13ч- заболевание протекало с тромбоцитозом (р & lt- 0,01). Трисомия 8 кор-
Клиническая онкогематология
релировала со спленомегалией (p & lt- 0,01), но симптомы опухолевой интоксикации отсутствовали (p & lt- 0,01). Одновременное наличие 13q- и мутации гена CALR у больных ПМФ определяют благоприятный прогноз [E.A. Wassie et al. Abstract 403].
Накопление данных о клинических и молекулярно-генетических особенностях МПН послужило поводом для пересмотра диагностических критериев, принятых в 2008 г.
На 56-м конгрессе ASH предложены диагностические критерии, которые будут приняты в 2015 г.
Эссенциальная тромбоцитемия
Большие критерии:
1. Постоянно повышенное число тромбоцитов (& gt- 450 X 109/л).
2. Наличие в костном мозге пролиферации мега-кариоцитов с преобладанием крупных и гигантских мегакариоцитов со зрелой морфологией. Отсутствует значительное увеличение или «левый сдвиг» элементов гранулоцитопоэза либо эритроцитопоэза.
3. Отсутствие других миелопролиферативных заболеваний.
4. Мутация JAK2V617 °F, MPL, CALR.
Малый критерий:
1. Отсутствие причин реактивного тромбоцитоза.
Для установления диагноза ЭТ необходимо наличие всех 4 больших или 1−3 больших и 1 малого критерия.
Первичный миелофиброз
Большие критерии:
1. Пролиферация и атипия мегакариоцитов, сочетающиеся с ретикулиновым и/или коллагеновым фиброзом костного мозга- при отсутствии выраженного ретикулинового фиброза — повышенная клеточность костного мозга с пролиферацией клеток гранулоцитарного ряда и угнетением эритропоэза (префиброзная клеточная фаза ПМФ).
2. Отсутствие критериев ИП, BCR/ABL1+ хронического миелолейкоза, миелодиспластического синдрома или других миелопролиферативных заболеваний.
3. Наличие мутаций JAK2V617 °F, MPL, CALR.
Малые критерии:
1. Исключение реактивного фиброза (инфекции, аутоиммунные заболевания, хроническое воспаление, волосатоклеточный лейкоз, другие злокачественные лим-фопролиферативные заболевания, метастазы солидных опухолей, токсические миелопатии).
2. Анемия или пальпируемая селезенка.
3. Лейкоэритробластоз или повышение активности лактатдегидрогеназы.
Для установления диагноза ПМФ необходимо наличие всех 3 больших или 1−2 больших и всех малых критериев.
Истинная полицитемия
Большие критерии:
1. Гемоглобин более 165 г/л у мужчин, более 160 г/л у женщин или гематокрит более 49% у мужчин, более 48% у женщин.
2. При биопсии костного мозга — трехростковая гиперплазия (панмиелоз): увеличение пролиферации элементов эритроидного, гранулоцитарного, мегакарио-цитарного ростков миелопоэза.
www. medprint. ru
3. Мутация гена JAK2V617 °F или мутация гена ]АК2 в экзоне 12.
Малый критерий:
1. Уровень эритропоэтина сыворотки ниже рефе-ренсных значений.
Для постановки диагноза ИП необходимо наличие всех 3 больших или 1−2 больших и 1 малого критерия.
прогноз
Для определения тактики терапии необходима оценка индивидуального прогноза у больного. Несмотря на то, что ряд молекулярных маркеров оказывает неблагоприятное влияние на исход, данные параметры не включены в практическую систему оценки прогноза. Как известно, большинство больных ЭТ без мутаций гена JAK2 или MPL имеют соматическую мутацию в гене CALR, ряд мутаций в других генах, участвующих в эпигенетической регуляции, сплайсинге mRNA, лейкозной трансформации. В то же время лечение препаратами интерферона a-2b может привести к редукции клона клеток, несущих мутацию JAK2V617 °F, а клетки, несущие мутацию гена TET2, устойчивы к интерферонотерапии. Однако недостаточно данных о чувствительности к интерферонам в случае МПН с другими мутациями. С целью изучить мутационный профиль JAK2-негативных больных ЭТ и определить прогностическую роль выявленных мутаций E. Verger и соавт. провели исследование с использованием секвенирования следующего поколения (Next Generation Sequencing, NGS). В исследование было включено 24 пациента с ЭТ без мутаций JAK2 или MPL, которые получали препараты интерферона-a. Средний возраст больных составил 52 года (диапазон 31−68 лет). Соотношение мужчины/женщины равно 1:2 (33 vs 67%). Длительность наблюдения составила от 1,5 до 9 лет. Продолжительность лечения препаратами интерферона a-2b равнялась 12−102 мес. (медиана 30 мес.). Полный или частичный гематологический ответ на фоне интерферонотерапии достигнут в 96% наблюдений (23 из 24 больных). Мутации гена CALR 1-го типа выявлены у 10 (42%) больных, 2-го типа — у 8 (33%), других типов — у 6 (25%). Дополнительные мутации обнаружены у 8 пациентов: ASXL1 (n = 2), TET2 (n = 2), IDH2 (n = 2), CSF3R (n = 1) и SH2B3 (n = 1). Динамическое наблюдение за больными с исследованием образцов крови в динамике позволило выявить, что аллельная нагрузка CALR снизилась с 43 (диапазон 8−57%) до 26% (диапазон 0−49%) (p = 0,018). Молекулярный ответ был определен как отсутствие выявления мутации гена CALR- частичный — как снижение аллельной нагрузки CALR & gt- 50%- минимальный — как снижение CALR на 49−50%- отсутствие ответа — как снижение аллельной нагрузки CALR & lt- 25%. Представляет интерес полученная информация о том, что молекулярный ответ на проводимую интерферонотерапию и прогноз были хуже у пациентов с дополнительными мутациями по сравнению с теми, у кого выявлена только мутация гена CALR: лечение было без ответа у 50% пациентов (vs 40%), процент клеток с мутацией CALR увеличился за период последующего наблюдения у 25% больных (vs 7%), а снижение аллельной нагрузки CALR, было в среднем 32% (vs 45%). В отличие от CALR, аллельная нагрузка других мутантных генов не изменялась. В данном исследовании за время наблюдения
205
(медиана 12 лет) новые мутации не были выявлены ни у одного пациента.
Можно сделать заключение, что при ЭТ с отсутствием мутации JAK2 V617 °F у 96% больных при проведении терапии препаратами интерферона a-2b можно получить гематологический ответ. Тем не менее мутационный фон оказывает влияние на молекулярный ответ при интерферонотерапии. Клоны с мутацией гена CALR высокочувствительны к интер-феронотерапии, в то время как клоны, несущие мутации в других генах, менее восприимчивы к терапии препаратами интерферона a-2b [E. Verger et al. Abstract 407].
У больных ПМФ прогноз на момент постановки диагноза определяется с использованием прогностической шкалы IPSS. При динамическом наблюдении рестади-рование осуществляется по динамической системе IPSS (DIPSS) или DIPSS +. Мутационный статус не включен в прогностические шкалы, однако мутации ASXL1, SRSF2, EZH2, ?DH1 /2 или случаи JAK2-/CALR-/MPL- оказывают неблагоприятное влияние на прогноз заболевания. A.M. Vannucchi и соавт. модифицировали IPSS, путем ее дополнения клинически значимыми мутациями. В исследование было включено 986 пациентов с ПМФ, которые находились под наблюдением в двух гематологических центрах: итальянская группа (n = 588) и пациенты, наблюдавшиеся в клинике Мейо (n = 398).
Медиана наблюдения в итальянской группе составила 3,6 года (95%-й доверительный интервал [95% ДИ] 0,03−30,8). За этот период умерло 196 (33,3%) больных, у 67 — констатировано прогрессирование заболевания с исходом в острый лейкоз. Распределение больных по группам риска IPSS было следующим: низкий риск — у 26%, промежуточный-1 — у 30%, промежуточный-2 — у 24%, высокий риск — у 20%. Мутации выявлены у большинства больных (JAK2 — 63%, CALR — 20%, MPL — 6%, EZH2 — 7%, ASXL1 — 22%, IDH½ — 2,5% и SRSF2 — 9%). Конституциональные симптомы присутствовали у 28,6% пациентов. Заболевание протекало со спленомегалией у 75% больных (у 18% пациентов селезенка более 10 см ниже края реберной дуги). Степень фиброза III степени при гистохимическом окрашивании трепанобиоптата костного мозга выявлена в 21% наблюдений. Цитоге-нетическое исследование проведено у 252 пациентов, нарушения кариотипа были обнаружены у 35%, из них 9,5% случаев классифицированы как неблагоприятные. Однофакторный анализ позволил выявить следующие признаки неблагоприятного прогноза: возраст старше 60 лет, конституциональные симптомы, анемия (гемоглобин менее 100 г/л), лейкоциты более 25×109/л, тромбоциты менее 200×109/л, бластные клетки в крови более 1%, спленомегалия более 10 см ниже края реберной дуги, фиброз костного мозга III степени, неблагоприятный кариотип, отсутствие мутаций генов JAK2, MPL и CALR (тройные негативные МПН), мутации ASXL1, SRSF2, EZH2 или IDH½. При многофакторном анализе возраст старше 60 лет, конституциональные симптомы, гемоглобин менее 100 г/л, тромбоциты менее 200×109/л, мутации ASXL1 и SRSF2 оставались значимыми факторами неблагоприятного прогноза. Этим переменным была присвоена следующая значимость в баллах: 1,5, 0,5, 0,5, 1,0, 1,5, 0,5 и 0,5 соответственно. Впоследствии выделены четыре группы риска: низкий (0−0,5 балла), промежуточный-1 (1 — 1,5 балла), про-
межуточный-2 (2−3,5 балла) и высокий (& gt- 4 баллов) (рис. 3, А). Разделенные по суммарному числу баллов, эти группы статистически значимо различаются по показателям общей выживаемости.
В группе больных из клиники Мейо медиана наблюдения составила 7,5 года. За время наблюдения умер 271 (68%) пациент, у 51 (13%) больного выявлено прогрессирование заболевания с исходом в острый лейкоз. Распределение пациентов по группам риска с использованием шкалы DIPSS+ следующее: низкий риск — у 13% больных, промежуточный-1 — у 18%, промежуточный-2 — у 37% и высокий — у 32%. Мутационный статус: JAK2 выявлен в 51% случаев, CALR — в 30%, MPL — в 7,5%, EZH2 — в 5%, ASXL1 — в 36%, IDH½ — в 5,6% и SRSF2 — в 13%. В данной когорте больных также подтверждено прогностическое значение нового индекса MIPSS (Molecular International Prognostic Score System) (рис. 3, Б). MIPSS имеет независимую прогностическую ценность и является шкалой, альтернативой DIPSS [A.M. Vannucchi et al. Mutation-Enhanced International Prognostic Scoring System (MIPSS) for
1,0.
0,8
3 0,6-
«0,43 ю О
0,2-
А
р = 0,0001
Промежуточный-1 риск n = 75 Медиана 9,7 года ОР 4,7 (95% ДИ 2,3−9,6)
Промежуточный-2 риск п = 259 Медиана 6,4 года
ОР 9,9 (95% ДИ 5,5−17,7)& quot- Высокий риск п = 74 Медиана 1,9 года ОР 36,5 (95% ДИ 19,4−68,9)
Низкий риск n = 151 Медиана 26,4 года
-1-
10
& quot-1-
15
--
20
-I-
25
30
Время, годы
1,0
0,8
0,6
0,4
3
ю О
0,2
-1-
35
Б
Низкий риск n = 52 Медиана 17,6 года
Промежуточный-1 риск n = 69 Медиана 7,8 года ОР 2,6 (95% ДИ 1,4−4,9)
Промежуточный-2 риск n = 209 Медиана 4,3 годаОР 6,3 (95% ДИ 3,6−11,0)
7,5 10 12,5 Время, годы
15 17,5 20 22,5
Рис. 3. Общая выживаемость больных в группах риска согласно прогностическому индексу MIPSS [A.M. Vannucchi et al. Abstract 405]:
A — итальянская группа больных- Б — больные, наблюдающиеся в клинике Мейо
95% ДИ — 95%-й доверительный интервал- ОР — отношение рисков.
Fig. 3. Overall survival rate of high-risk group patients according to MIPSS prognostic index [A.M. Vannucchi et al. Abstract 405]: A — patients in Italy- Б — patients in the Mayo Clinic 95% ДИ — 95% confidence interval- ОР — hazard ratio.
206
Клиническая онкогематология
0
5
0
Primary Myelofibrosis: An AGIMM & amp- IWG-MRT Project. Abstract 405].
Для определения прогноза у больных ПМФ используют международные прогностические системы, которые основаны на оценке клинических параметров, цитогене-тических характеристиках [Blood 2011- 118: 4595]. В ряде исследований показано прогностическое значение молекулярных аномалий [NEJM 2013- 369: 2379- Leukemia 2013- 27: 1861].
Для оценки прогностической значимости генетических аберраций проведено клиническое исследование с включением 964 больных. Пациенты наблюдались в клинике Мейо. Средний возраст больных 65 лет- соотношение мужчины/женщины 1,3:1 (62 vs 48%). Цито-генетическое исследование проведено у 903 (94%) пациентов. Исследование мутационного статуса JAK2/CALR/ MPL выполнено у 532 (55%) участников, ASXL1 — у 425 (44%), SRSF2 — у 434 (45%), IDH½ — у 376 (39%) и EZH2 — у 268 (28%). Распределение больных по группам риска согласно шкале DIPSS+ было следующим: высокий риск — 37%, промежуточный-1 — 15%, про-межуточный-2 — 37%, низкий — 11%.
Пациенты были стратифицированы на 4 категории цитогенетического риска: очень высокий риск — моно-сомный кариотип, inv (3), i (17q), -7/7q-, аберрации 11q или 12p (n = 67) — высокий риск — комплексный не-моносомный кариотип, две цитогенетические аномалии, не включенные в категорию очень высокого риска, 5q-, трисомия хромосомы 8, другие трисомии, кроме +9, и остальные цитогенетические нарушения, не включенные в другие категории риска (n = 164) — промежуточный риск — изолированная 20q-, 1q+ или любые другие изолированные транслокации и -Y либо другие хромо -сомные аномалии, связанные с половыми хромосомами (n = 133) — низкий риск — нормальный кариотип либо изолированные 13q- или +9 (n = 539).
Мутационный статус: 58% - JAK2, 25% - CALR, 7% - MPL, 36% - ASXL1, 11% - SRSF2, 5% - IDH½ и 6% - EZH2. В 131 наблюдении выявлены мутации гена CALR: тип 1 (n = 110) и тип 2 (n = 21).
Медиана наблюдения за больными составила 4,2 года. За время наблюдения 664 (69%) больных умерли, у 70 (7%) было прогрессирование заболевания с исходом в острый лейкоз. При проведении многофакторного анализа сформированы следующие группы: очень высокого цитогенетического риска (отношение рисков [ОР] 4,2- 3 балла), высокого цитогенетического риска (ОР 1,9- 1 балл), с тройным негативным МПН (ОР 2,8- 2 балла), JAK2 (ОР 3,1- 2 балла), MPL (ОР 3,1- 2 балла), с мутацией гена CALR, типа 2 (ОР 3,6- 2 балла), ASXL1 (ОР 1,9- 1 балла) и SRSF2 (ОР 1,9- 1 балл). Такие показатели, как EZH2 (p = 0,24) и IDH½ (p = 0,68), а также промежуточный цитогенетический риск (p = 0,87) не были статистически значимыми.
На основании проведенного исследования с включением 369 больных разработан прогностический индекс GPSS (Genetics-Based Prognostic Scoring System): благоприятный прогноз (0 баллов), промежуточный-1 (1−2 балла), промежуточный-2 (3−4 балла) и неблагоприятный прогноз (& gt- 5 баллов). В соответствии с этими группами медиана выживаемости была более 17,9 (ОР 4,7- 95% ДИ 1,7−13,0), 5 (ОР 10,7- 95% ДИ 3,9−29,3) и 2,2 года (ОР 29,2- 95% ДИ 10,6−80,0) (рис. 4). Па-
www. medprint. ru
1,0 0,8 0,6 0,4 0,2 0
Благоприятный прогноз
n = 31 Медиана не достигнута
Ч Промежуточный-1 прогноз 1 n = 90
* j Медиана 9 лет
р = 0,0001
Промежуточный-2 прогноз n = 133 т Медиана 5 лет Неблагоприятный прогноз: --.
п = 115 едиана 2,2 года
2,5
7,5 10 12,5 Время, годы
15 17,5 20 22,5
Рис. 4. Общая выживаемость пациентов с первичным миело-фиброзом из клиники Мейо в соответствии с прогностическим индексом GPSS (n = 369) [A. Tefferi et al. Abstract 406]
Fig. 4. Overall survival rate of patients with primary myelofibrosis in the Mayo Clinic in accordance with the GPSS prognostic index (n = 369) [A. Tefferi et al. Abstract 406]
циенты из группы неблагоприятного прогноза по GPSS характеризовались высоким риском прогрессирования заболевания с исходом в острый лейкоз (ОР 7,4- 95% ДИ 2,1−26,3).
Прогностическое различие общей выживаемости и выживаемости без лейкоза между группами больных с высоким/промежуточным-2 и низким/промежу-точным-1 прогнозом по GPSS было подтверждено в независимом исследовании Университета Флоренции на когорте из 183 пациентов (рис. 5) [A. Tefferi et al. Integration of Mutations and Karyotype Towards a Genetics-Based Prognostic Scoring System (GPSS) for Primary Myelofibrosis. Abstract 406].
3
ю О
1,0
0,8
0,6
0,4
0,2
0
р = 0,0001
Благоприятный промежуточный-1 прогноз n = 68 Медиана 26,4 года
Неблагоприятный промежуточный-2 прогноз n = 115 Медиана 4,97 года ОР 7,07 (95% ДИ 3,3−14,9)
10
15 20 Время, мес.
25
30
Рис. 5. Общая выживаемость пациентов с первичным миело-фиброзом из Университета Флоренции в соответствии с прогностическим индексом GPSS (n = 183) [A. Tefferi et al. Abstract 406]
95% ДИ — 95%-й доверительный интервал- ОР — отношение рисков.
Fig. 5. Overall survival rate of patients with primary myelofibrosis in Florence University in accordance with the GPSS prognostic index (n = 183) [A. Tefferi et al. Abstract 406] 95% ДИ — 95% confidence interval- ОР — hazard ratio.
207
0
5
0
5
ИП и ЭТ могут прогрессировать с развитием вторичного миелофиброза — постполицитемического (пост-ИП МФ) и посттромбоцитемического миелофиброза (пост-ЭТ МФ). В то время как прогноз при ПМФ определяется на основе ряда прогностических шкал (IPSS, DIPSS, DIPSS +, MIPSS, GPSS), прогностических систем для вторичного миелофиброза не существует.
С целью разработать прогностическую модель для оценки выживаемости больных вторичным миелофи-брозом проведено исследование с включением 718 пациентов из 16 международных центров. Из 718 пациентов 364 (51%) были с пост-ЭТ МФ и 354 (49%) с пост-ИП МФ. Средний период наблюдения составил 2,4 года (диапазон 0,6−20,1 года). Средний возраст был 64 года (диапазон 25−96 лет), 370 (52%) участников — мужчины. Среднее время от установления диагноза ИП или ЭТ до развития вторичного миелофиброза составило 10,6 года (диапазон 2,5−41 года). Со спленомегалией заболевание протекало у 606 (87%) больных. Конституциональные симптомы присутствовали у 329 (47%) пациентов. Цитогенетиче-ское исследование выполнено 338 больным. Нормальный кариотип выявлен у 222 (66%) больных, цитогенетиче-ский риск определен как высокий у 40 (12%) пациентов, как низкий — у 76 (22%). Мутация V617 °F гена JAK2 обнаружена у 679 (73%) пациентов. Анемия, лейкоцитоз, тромбоцитопения, пожилой возраст, бластные клетки в периферической крови, JAK2V617 °F, конституциональные симптомы, время от постановки диагноза ЭТ или ИП до развития миелофиброза, тромбозы в анамнезе оказывают неблагоприятное влияние на общую выживаемость, что было показано при проведении однофакторного анализа (p = 0,043). В то же время диагноз (пост-ЭТ МФ или пост-ИП МФ), спленомегалия, цитогенетический риск и сопутствующие сердечно-сосудистые заболевания не показали неблагоприятного воздействия на общую выживаемость. В многофакторном анализе выявлено, что возраст старше 65 лет (ОР 2,6- 95% ДИ 1,5−4,4- p & lt- 0,0001), время от постановки диагноза ИП или ЭТ до развития вторичного миелофиброза более 15 лет (ОР 1,7- 95% ДИ 1,3−2,2- p & lt- 0,0001), тромбоз в анамнезе (ОР 2,1- 95% ДИ 1,2−3,6- p = 0,01), наличие конституциональных симптомов (ОР 1,8- 95% ДИ 1,3−2,6- p = 0,001), уровень гемоглобина менее 100 г/л (ОР 1,5- 95% ДИ 1,1−2,0- p = 0,004) и бластные клетки в периферической крови более 1% (ОР 2,1- 95% ДИ 1,5−2,8- p & lt- 0,0001) оказывают неблагоприятное влияние на общую выживаемость.
Для разработки прогностической модели каждому фактору было присвоено значение в баллах: возраст старше 65 лет — 3 балла, время до развития вторичного миелофиброза более 15 лет — 2 балла, тромбоз в анамнезе — 2 балла, конституциональные симптомы — 2 балла, гемоглобин менее 100 г/л — 1 балл и бластные клетки в периферической крови 1% и более — 2 балла. Шкала MYSEC-PM включает три категории: низкий риск (0−2 балла), средний риск (3−6 баллов), высокий риск (& gt- 6 баллов). Общая выживаемость различалась у пациентов из разных групп риска (p & lt- 0,0001). Медиана выживаемости в группе низкого риска не достигнута, в группе промежуточного риска составила 7,9 года (95% ДИ 6,7−9,3), а в группе высокого — 3,8 года (95% ДИ 2,2−5,0) (рис. 6).
p & lt- 0,0001
низкии риск промежуточный риск высокий риск
0 О 5 10 15 20
Время от установления диагноза вторичного миелофиброза, годы
Рис. 6. Кумулятивная общая выживаемость больных вторичным постполицитемическим и посттромбоцитемическим миелофиб-розом в соответствии с прогностической моделью MYSEC-PM (n = 718) [F. Passamonti et al. Abstract 1826]
Fig. 6. Cummulative overall survival rate of patients with secondary post-polycythemia vera and post-essential thrombocythemia myelofibrosis in accordance with MYSEC-PM prognostic model (n = 718) [F. Passamonti et al. Abstract 1826]
Авторы делают заключение, что прогностическая модель MYSEC-PM может быть использована при выборе лечебной тактики с учетом ожидаемой продолжительности жизни больных [F. Passamonti et al. A New International Multicenter-Based Model to Predict Survival in Myelofibrosis Secondary to Polycythemia and Thrombocythemia The Mysec Prognostic Model (MYSEC-PM). Abstract 1826].
Пациенты с МПН имеют высокий риск тромботи-ческих осложнений по сравнению с общей популяцией. M. Hultcrantz и соавт. провели популяционное исследование оценки риска артериальных и венозных тромбозов у больных МПН в сравнении с контрольной группой [M. Hultcrantz. Risk of Arterial and Venous Thrombosis in 11,155 Patients with Myeloproliferative Neoplasms and 44,620 Matched Controls- A Population-Based Study. Abstract 632]. В исследование включено 11 155 пациентов с МПН из национального регистра рака, контрольная группа составила 44 620 человек из реестра общей численности населения. Средний возраст при постановке диагноза МПН был 69 лет. Соотношение мужчины/ женщины составило 1: 1,2. Артериальный тромбоз был определен как инфаркт миокарда, ишемический инсульт или тромбоэмболия легочной артерии. Венозный тромбоз был определен как легочная эмболия, тромбоз глубоких вен, тромбоз воротной, селезеночной, мезентериальных вен, тромбоз церебральных венозных синусов. Частота артериальных и венозных тромбозов в момент постановки диагноза МПН (± 30 дней) составила 55 (95% ДИ 51,1 — 59,2%- p & lt- 0,001) и 64,3% (95% ДИ 42,2−98,1%- p & lt- 0,001) в сравниваемых группах.
У больных МПН по сравнению с контрольной группой риск артериального тромбоза был в 4,9 раза выше (95% ДИ 4,8−5,0- p & lt- 0,001), риск инфаркта миокарда — в 3,9 раза выше (95% ДИ 3,7−4,1- p & lt- 0,001), а инсульта — в 4,9 раза выше (95% ДИ 4,8−5,0- p & lt- 0,001). Риск артериального тромбоза у пациентов с МПН снижался сразу после установления диагноза, однако возрастал при динамическом наблюдении (рис. 7). По сравнению с
208
Клиническая онкогематология


зь 1 1
30 I
1
S о S 25 1 1
ф S X ф 3 о X 20
15 I
о 10 V

0
0 10 20 Время от установления диагноза, годы 30
Рис. 7. Риск артериальных тромбозов у больных миелопроли-феративными неоплазиями [M. Hultcrantz. Abstract 632]
Fig. 7. Risk of arterial thrombosis in patients with myeloproliferative neoplasms [M. Hultcrantz. Abstract 632]
Рис. 8. Риск венозных тромбозов у больных миелопролифера-тивными неоплазиями [M. Hultcrantz. Abstract 632]
Fig. 8. Risk of venous thrombosis in patients with myeloproliferative neoplasms [M. Hultcrantz. Abstract 632]
контрольной группой ОР артериального тромбоза у пациентов с ИП составило 5,0 (95% ДИ 4,8−5,2), с ЭТ — 4,7 (95% ДИ 4,6−5,0), с ПМФ — 5,0 (95% ДИ 4,7−5,3) и с МПН неклассифицируемым — 5,1 (95% ДИ 4,8−5,5).
ОР венозного тромбоза у пациентов МПН составило 6,7 (95% ДИ 6,2−7,2- p & lt- 0,001), эмболии легочной артерии — 7,5 (95% ДИ 6,6−8,5- p & lt- 0,001) и тромбоза глубоких вен — 5,3 (95% ДИ 4,8−5,9- p & lt- 0,001) по сравнению с контрольной группой- ОР тромбоза воротной, селезеночной, мезентериальных вен у больных МПН — 41,4 (95% ДИ 26,4−64,9- p & lt- 0,001). Риск венозного тромбоза у пациентов с МПН снижался сразу после установления диагноза, а затем оставался стабильным во время периода наблюдения (рис. 8). Пациенты с ИП имели больший риск венозного тромбоза по сравнению с контрольной группой (больные ЭТ и ПМФ) (ОР 9,0- 95% ДИ 8,0−10,1), в то время как риск венозного тромбоза у пациентов с ЭТ (ОР 5,4- 95% ДИ 4,7−6,2), ПМФ (ОР 6,0- 95% ДИ 4,9−7,5) и МПН неклассифицируемыми (ОР 4,6- 95% ДИ 3,7−5,7) был значительно выше.
Таким образом, у пациентов с МПН риск тромбо-тических осложнений в 5−7 раз выше по сравнению с общей популяцией. Полученные результаты показывают, что гематологи после установления диагноза МПН должны учитывать риск тромбозов, а пациентам должна проводиться профилактика тромботических осложнений [M. Hultcrantz et al. Abstract 632].
Тромбозы воротной, селезеночной, мезентериальных вен являются причиной таких осложнений, как портальная гипертензия, варикозное расширение вен пищевода и желудка, асцит, печеночная недостаточность. По данным метаанализа, МПН являются основной причиной тромбоза воротной вены (31,5%) и синдрома Бадда-Киари (40,9%) [H.J. Smalberg et al., 2012].
С целью охарактеризовать клинические особенности, течение заболевания и прогностические факторы двумя группами ученых (Gruppo Italiano Malattie Mieloproliferative [AGIMM] и International Working Group — Myeloproliferative Neoplasms Research and Treatment [IWG-MRT]) проведено исследование с участием 16 гематологических центров.
www. medprint. ru
В исследование включено 519 пациентов с МПН и тромбозом воротной, селезеночной, мезентериальных вен (75,1%) или синдромом Бадда-Киари (24,9%). В качестве группы сравнения выступила когорта из 1686 пациентов с МПН без тромбоза: ЭТ — 741 (43,9%) случай, ИП — 684 (39,7%), ПМФ — 261 (16,4%). Медиана наблюдения составила 89,9 мес. (диапазон 0,5−430 мес.).
Средний возраст на момент постановки диагноза МПН составил 43,5 (диапазон 12−90 лет) ив 60,6 года (диапазон 12−93 года) в контрольной группе (р & lt- 0,0001). Возраст в группе больных МПН с абдоминальными тромбозами был 44 года (диапазон 15−85 лет). В 121 (23,6%) наблюдении абдоминальный тромбоз диагностирован до развития МПН в среднем за 26 мес. (диапазон 4−307 мес.) и в 153 (29,8%) наблюдениях после диагностики МПН в среднем через 68 мес. (диапазон 4−362 мес.). Мутация JAK2 V617 °F была выявлена у больных ИП с тромбозами и в контрольной группе в равном числе наблюдений — 94%, у больных ЭТ — в 84 и 61% (р & lt- 0,0001), у больных ПМФ — в 88,1 и 68% соответственно (р = 0,006). В группе больных ИП с тромбозом уровень гемоглобина был статистически значимо ниже по сравнению с контрольной: медиана 174 ив 185 г/л (р & lt- 0,0001). Полиморфизмы генов тром-бофилии выявлены у 38,5% больных МПН с тромбозами ив 11,8% в контрольной группе (р & lt- 0,0001). Риск повторного венозного тромбоза был выше в группе больных МПН с тромбозом в сравнении с контрольной группой (р = 0,02), различий в риске артериального тромбоза не выявлено. Геморрагические осложнения были более частыми в группе МПН с тромбозами (32%) в сравнении с контрольной группой (7,2%) (р & lt- 0,0001), в основном связанные с варикозным расширением вен пищевода.
Различий в прогрессировании ИП и ЭТ с развитием вторичного миелофиброза или исходом в острый лейкоз не выявлено. В то же время риск острого лейкоза был ниже в группе больных ПМФ с тромбозом (р & lt- 0,1). Общая выживаемость была хуже у больных ЭТ с тромбозом в сравнении с контрольной группой (р & lt- 0,0001). В группе больных ПМФ с тромбозами распределение по
209
группам риска было следующим: низкий риск — 65%, промежуточный-1 — 20%, промежуточный-2 — 10% и высокий — 5% по сравнению с 15, 34, 25 и 26% в контрольной группе соответственно. При ПМФ выживаемость была лучше в группе больных с тромбозами (p & lt- 0,1), что было связано с большой долей пациентов из группы низкого риска по IPSS. Причинами смерти пациентов были прогрессирование заболевания с исходом в острый лейкоз (15,4%), другие онкологические заболевания (13,8%), прогрессирование заболевания без трансформации в острый лейкоз (10,8%), повторные тромбозы воротной, селезеночной, мезентериальных вен (10,8%), печеночная недостаточность и тромбоз других вен (по 7,7%), сердечная недостаточность и другие артериальные тромбозы (по 6,2%), кровотечение (5,5%), почечная недостаточность и инфекции (по 4,6%). Терапия после состоявшегося тромбоза включала антикоагулянты в 77% случаев, антиагреганты — в 21,2%, их сочетание — в 1,8%- 70% больных получали цитотоксические препараты, 12,4% - проведено хирургическое лечение (трансъюгулярный внутрипече-ночный портосистемный шунт). в-блокаторы назначены 48,5% больных. Терапия в-блокаторами коррелировала с улучшением выживаемости (p = 0,041).
Таким образом, больные МПН с тромбозами — преимущественно женщины, молодого возраста. Тромбоз служит первым проявлением МПН у ¼ больных. В случае ИП и ЭТ в большинстве наблюдений выявляют мутацию JAK2 V617 °F или полиморфизмы генов тромбо-филии. Группа пациентов с ПМФ и тромбозом требует дальнейшего наблюдения [L. Pieri et al. Abstract 3163].
Поскольку у большинства больных МПН характеризуется медленным, индолентным течением, все больше внимания уделяется сопутствующим заболеваниям. Коморбидность — сосуществование двух и/или более синдромов либо заболеваний у одного пациента, патогенетически взаимосвязанных между собой или совпадающих по времени. В случаях МПН степень влияния сопутствующей патологии на состояние пациента может быть разной. Сосуществующие заболевания могут сопровождаться клиническими проявлениями, которые существенно влияют на общее состояние и качество жизни пациента, а также способны лимитировать возможности проведения терапии, в том числе, таргетной. В случае классических Ph-негативных МПН остается неясным, какой индекс ко-морбидности следует использовать для оценки сопутствующих заболеваний. Самый популярный индекс Чарлсона (Charlson Index) используется для прогноза летальности. Кумулятивная шкала рейтинга заболеваний (Cumulative Illness Rating Scale [CIRS]) оценивает все системы организма без учета определенного диагноза.
В группе из 125 пациентов с МПН, наблюдавшихся в клинике Аахен (Германия), проведена оценка значимости индексов коморбидности CIRS и Charlson. Мужчины составили 57%, возраст больных 26−88 лет (средний возраст 62 года). Средний балл CIRS был 4 (диапазон 0−22 балла), средний балл Charlson — 0 (диапазон 0−8 баллов). Больные ПМФ характеризовались высокими средними баллами CIRS и Charlson (средний CIRS — 9, Charlson — 2). Больные МПН с тромбогеморрагическими осложнениями имели средний CIRS 7,5 балла и средний Charlson 1 балл. Больные без осложнений имели средние показатели CIRS и Charlson
210
3 и 0 баллов соответственно. Средний возраст больных с осложнениями был несколько выше — 68,5 года в сравнении с группой без осложнений (58 лет). По шкале CIRS в группе с осложнениями медиана составила 58% (5 из 14 баллов). Неблагоприятное влияние на результаты лечения МПН оказывают гипертензия и другие болезни сердечно-сосудистой системы и почек, а также метаболические заболевания (табл. 3).
Шкала коморбидности CIRS разработана для пациентов пожилого возраста с целью определить профили риска при сердечно-сосудистых и метаболических заболеваниях. Оценка Charlson была создана для больных среднего и молодого возраста, однако ряд сопутствующих заболеваний (гипертензия и болезни обмена веществ) не включен в данную шкалу. В совокупности это свидетельствует о необходимости разработки шкалы коморбидности для больных МПН [S. Isfort et al. Comorbidity Scales in Patients with Myeloproliferative Neoplasms: Which One Fits Best. Abstract 1828].
лечение
Лечение больных МПН развивалось одновременно с пониманием молекулярного патогенеза этих заболеваний. В 2005 г. открыта мутация J4K2V617 °F, которая присутствует у 95% больных ИП, 50−60% больных ПМФ и ЭТ. Другие мутации, такие как JAK2 в экзоне 12, MPL, CALR, ТР53, ТЕT2, ASXL1, IDHl/2, EZH2, играют важную роль в патогенезе МПН и определяют особенности клинического течения, прогноз заболевания, эффективность проводимой терапии. После открытия мутации гена JAK2 разработаны таргетные препараты — ингибиторы ЛАК2. В настоящее время зарегистрирован только руксолитиниб, другие препараты находятся на стадии клинических исследований. Тактику ведения больных МПН можно разделить на наблюдение и симптоматическую терапию, проведение медикаментозного лечения и аллогенную трансплантацию гемопоэтиче-ских стволовых клеток (аллоТГСК). Медикаментозная терапия включает в себя циторедуктивное лечение, монотерапию ингибиторами ЛАК2, комбинированную терапию. Успешное лечение больных МПН возможно только при активном наблюдении и последовательном выборе подходов к терапии.
Таблица 3. Результаты оценки по шкалам коморбидности [S. Isfort. Abstract 1828]
Все больные ИП ЭТ ПМФ Пост-ЭТ, пост-ИП МФ ХМЛ СМ
Число больных 125 20 36 27 17 11 14
Медиана возраста, лет 62 62,5 54 68 74 61 49,5
ШБ (без лейкоза) 4 5,5 3 5 9 3 4
ШБ (включая лейкоз) 6 7 5 6 11 5 5,5
СИэИзоп (без лейкоза) 0 1 0 0 2 0 0
СИэИзоп (включая лейкоз) 2 3 2 2 4 2 2
Больные МПН с осложнениями (n = 42)
ШБ (без лейкоза) 7,5
ШБ (включая лейкоз) 9,0
СИэИзоп (без лейкоза) 1,0
СИэИзоп (включая лейкоз) 3,0
СМ — системный мастоцитоз- ХМЛ — хронический миелолейкоз.
Клиническая онкогематология
АллоТГСК в настоящее время является единственным методом, позволяющим излечить больных. В первую очередь кандидатами на аллоТГСК являются больные ПМФ с ожидаемой продолжительностью жизни менее 5 лет (промежуточный-2 и высокий риск по шкале DIPSS). Однако отсутствуют проспективные рандомизированные исследования, которые позволяют оценить критерии для отбора пациентов на выполнение аллоТГСК. Проведение аллоТГСК является сложным вопросом, с учетом риска осложнений, связанных с самой процедурой (развитие недостаточности трансплантата, реакция „трансплантат против хозяина“, токсичность режимов кондиционирования), состояния пациентов (возраст, трансфузионно-зависимая анемия), наличие HLA-идентичного донора.
Симптоматическая терапия (антиагреганты, крово-пускания/эритроцитаферез) должна проводиться всем больным МПН. Низкие дозы ацетилсалициловой кислоты назначают для профилактики сердечно-сосудистых осложнений при ИП и ЭТ. В исследовании ECLAP показано статистически значимое снижение риска сердечно-сосудистых осложнений без существенного увеличения риска кровотечений у больных ИП, которые получали профилактическую терапию антиагрегантами. Всем больным ИП независимо от риска развития тромбогеморрагических осложнений и больным ЭТ при наличии микрососудистых симптомов показана терапия низкими дозами ацетилсалициловой кислоты при отсутствии абсолютных противопоказаний. Роль ацетилсалициловой кислоты в лечении больных ЭТ, отнесенных в группу низкого риска тромбогеморрагиче-ских осложнений, остается неизученной.
В соответствии с рекомендациями ELN (European LeukemiaNet) показанием к назначению циторедуктивной
терапии служит ИП или ЭТ с высоким риском тромбогеморрагических осложнений. Препаратом первой линии является гидроксимочевина, применение которой снижает риск тромбозов. Анагрелид — препарат второй линии терапии при ЭТ. Однако в исследовании ANAHYDRET (Anagrelide vs. Hydroxyurea — Efficacy and Tolerability Study in Patients With Essential Thrombocythaemia), включавшем 259 больных ЭТ с высоким риском тромбо-геморрагических осложнений, не выявлено различий в частоте артериальных и венозных тромбозов, кровотечений и отмены терапии при сравнении анагрелида и гидроксимочевины.
У больных ИП и ЭТ терапия препаратами пегилиро-ванного интерферона a-2a служит альтернативой гидрок-симочевине. При лечении препаратами пегилированного интерферона a-2a возможно достижение полного гематологического ответа в 76% наблюдений при ИП и в 77% - при ЭТ. Данная терапия приводит к снижению аллельной нагрузки JAK22. В настоящее время проводится рандомизированное многоцентровое исследование по сравнению эффективности и безопасности гидроксимочевины и пегилированного интерферона a-2b у больных ИП высокого риска (Pegylated Interferon Alpha-2b Versus Hydroxyurea in Polycythemia Vera, PROUD-PV).
Больным с ЭT при резистентности/непереносимости гидроксимочевины и анагрелида могут быть назначены препараты интерферона.
Алгоритм лечения больных ЭТ и ИП представлен на рис. 9.
Руксолитиниб является первым таргетным препаратом (ингибитором JAK2) при ПМФ. Руксолитиниб приводит к сокращению размеров селезенки, купированию сим-
Рис. 9. Алгоритм лечения больных эссенциальной тромбоцитемией и истинной полицитемией [цит. по: Geyer H.L., Mesa R.A. Therapy for myeloproliferative neoplasms: when, which agent, and how? Blood. 2014- 124: 3529−37]
Fig. 9. Algorithm of treatment of essential thrombocythemia and polycythemia vera [cited according to Geyer H.L., Mesa R.A. Therapy for myeloproliferative neoplasms: when, which agent, and how? Blood. 2014- 124: 3529−37]
www. medprint. ru 211
Fig. 10. Algorithm of treatment of patients with myelofibrosis [cited according to Geyer H.L., Mesa R.A. Therapy for myeloproliferative neoplasms: when, which agent, and how? Blood. 2014- 124: 3529−37]
птомов опухолевой интоксикации. Отдаленные результаты демонстрируют лучшую общую выживаемость больных, получающих руксолитиниб. В исследовании COMFORT-II показано снижение риска смерти на 42% в группе руксо-литиниба по сравнению с наилучшей доступной терапией (ОР 0,58- 95% ДИ 0,36−0,93), ожидаемая общая выживаемость составила 71 и 54% соответственно при длительности наблюдения 3,5 года. Лечение руксолитинибом эффективно при ПМФ с кахексией: увеличение массы тела наблюдалось у 96% пациентов, повышение уровня общего холестерина — у 97%.
Алгоритм лечения больных ПМФ представлен на рис. 10.
клинические исследования. перспективы лечения больных рн-негативными миелопролиферативными неоплазиями
В настоящее время проводятся клинические исследования II фазы по применению руксолитиниба при ИП и ЭТ. В исследование включено 34 больных ИП с непереносимостью/резистентностью к гидроксимочевине. Длительность терапии руксолитинибом в среднем составила 152 нед., что позволило снизить и поддерживать уровень гематокрита менее 45% без кровопусканий/эритроцита-фереза. Сокращение размеров селезенки к 24-й неделе терапии достигнуто у 97% больных ИП и у 44% с ЭТ. У всех пациентов отмечается купирование симптомов опухолевой интоксикации. RESPONSE — многоцентровое рандомизированное исследование III фазы по оценке эффективности и безопасности руксолитиниба в сравнении с наилучшей доступной терапией у больных ИП с непереносимостью/резистентностью к гидроксимочевине. К 32-й неделе терапии уменьшение селезенки и полная
212
гематологическая ремиссия достигнуты соответственно у 71,8 и 23,6% больных, получавших лечение руксолитинибом, по сравнению с 33 и 8,9% в группе, получавшей наилучшую доступную терапию.
Поскольку в основе патогенеза МПН лежит активация сигнальных путей JAK-STAT с каскадной активацией сигнальных путей STAT3/5, PBK, MAPK, обосновано проведение комбинированной терапии с воздействием на различные этапы патогенеза. Это легло в основу клинических исследований по проведению комбинированной терапии с включением ингибиторов JAK2 и низкомолекулярных препаратов, которые обладают синергизмом и позволяют нивелировать/компенсировать ряд побочных эффектов, например анемию.
PI3K/AKT/mTOR — внутриклеточный сигнальный путь, центральными компонентами которого являются фосфатидилинозитол-3-киназа (PI3K), киназа AKT и мишень рапамицина млекопитающих (mTOR). Это один из универсальных сигнальных путей, характерных для большинства клеток человека. Он отвечает за „уход“ от апоптоза, рост, пролиферацию клеток, метаболизм. Ингибиторы PI3K в сочетании с руксолитинибом продемонстрировали значительный антипролиферативный эффект за счет потенцирования чувствительности клеток к данному классу препаратов при комбинированной терапии с ингибиторами JAK2. mTOR функционирует аналогично регуляторной серин-треонинкиназе, важной для клеточного метаболизма, апоптоза и пролиферации. Комбинированная терапия с включением ингибиторов mTOR не приводит к снижению аллельной нагрузки JAK2, что может свидетельствовать о наличии альтернативных путей регуляции.
Гистондеацетилазы (HDAC) — ферменты, которые модифицируют гистоны и изменяют конформацию хрома-
Клиническая онкогематология
Таблица 4. Новые лекарственные препараты и комбинированная терапия при миелопролиферативных неоплазиях Вид противоопухолевой терапии Ингибитор JAK (мишень) Второй препарат Фармакологическая группа второго препарата Вариант МПН
Монотерапия Пакритиниб (JAK2, FLT3) — - ПМФ
Момелотиниб (JAK1, JAK2) — - ПМФ, ИП, ЭТ
NS-018 (JAK2) — - ПМФ
INCB-39 110 — - ПМФ
Комбинированная терапия Руксолитиниб (МК1, МК2) Даназол Андроген ПМФ
Руксолитиниб (МК1, МК2) Помалидомид Иммуномодулятор ПМФ Руксолитиниб (МК1, МК2) Талидомид Иммуномодулятор ПМФ Руксолитиниб (МК1, МК2) Азацитидин Гипометилирующий агент ПМФ Руксолитиниб (МК1, иДК2) Панобиностат Ингибитор ШДС ПМФ Руксолитиниб (МК1, иДК2) 68−6624 Антифибротический агент ПМФ Руксолитиниб (МК1, МК2) РИМ-151 Антифибротический агент ПМФ Руксолитиниб (МК1, иДК2) ВКМ-120 Ингибитор Р13-киназы ПМФ Руксолитиниб (МК1, МК2) ЬЭЕ-225 Ингибитор сигнального пути МдИеИод ПМФ Руксолитиниб (МК1, МК2) АллоТГСК — ПМФ _Руксолитиниб (ЦДК1, МК2) АллоТГСК_-_ПМФ
тина, играют важную роль в регуляции экспрессии генов. Ингибиторы гистондеацетилазы (гивиностат) также являются рациональной терапией МПН. В исследованиях in vitro продемонстрировано, что JAK2V617F-позитивные клетки в 2−3 раза более чувствительны к ингибиторам HDAC по сравнению с JAK2-негативными клетками.
Секреторные белки семейства Hedgehog играют важную роль в регуляции клеточной дифференцировки в процессе эмбриогенеза. В литературе рассматривается и другая модель участия Hedgehog-зависимого сигнального каскада в канцерогенезе. В ее основе лежит предположение о гиперэкспрессии Hedgehog-белков как первопричине малигнизации клеток. Эта модель предполагает, что стимулятором повышенной пролиферации и выживаемости опухолевых клеток являются аутокринные сигналы, которые воспринимаются Hedgehog-белками, синтезируемыми самой же опухолью. Данная модель подтверждается результатами экспериментов in vitro, согласно которым Hedgehog-белки стимулировали пролиферацию опухолевых клеток, а моноклональные антитела, нейтрализующие Hedgehog-белки, ингибировали этот процесс. Таким образом, сигнальный путь Hedgehog может быть потенциальной мишенью в терапии МПН.
Антифибротические препараты функционируют как эндогенные белки, которые активируются при повреждении местных тканей и стимулируют дифференцировку макрофагов и моноцитов с последующим обратным развитием фиброза. В клинических исследованиях II фазы антифибротический препарат пентраксин (PTX-2) продемонстрировал регрессию фиброза костного мозга,
нормализацию показателей гемограммы, купирование симптомов интоксикации и сокращение размеров селезенки.
Иметелстат — мощный ингибитор теломеразы, который оказывает селективное воздействие на фиброз в костном мозге, показал высокую эффективность в достижении молекулярных, гематологических ремиссий и в обратном развитии фиброза костного мозга у больных ПМФ.
Иммуномодулирующие препараты высокоэффективны для лечения анемии и тромбоцитопении.
Ряд препаратов проходит клинические исследования в комбинации с ингибиторами ЛАК2 (табл. 4).
заключение
За последние 10 лет, прошедших со времени открытия мутации 1ЛК2V617 °F, достигнут беспрецедентный прогресс в понимании биологии МПН, что привело к развитию новых терапевтических возможностей. Лечение МПН требует индивидуализированного подхода, который включает в себя оценку сопутствующих заболеваний, прогноза, своевременное принятие решения о проведении аллоТГСК. Ингибиторы ЛАК2 зарекомендовали себя как эффективные препараты для лечения больных ПМФ и ИП (в рамках клинических исследований). В настоящее время проводятся клинические исследования комбинированной терапии, что позволит повысить эффективность и снизить токсичность лечения.
j. medprint. ru
213
МИЕЛОДИСПЛАСТИЧЕСКИЕ СИНДРОМЫ
Подготовил канд. мед. наук А.Д. Ширин
На конгрессе АБН-2014 миелодиспластические синдромы (МДС) рассматривались в рубрике „По-стерные и устные доклады“, а также „Образовательная программа“.
Постерные и устные доклады были посвящены следующим основным направлениям:
• биология, патогенез, диагностика-
• прогноз-
• лечение.
Образовательная программа включала в себя лекции:
• „Одобренные к применению и новые препараты для лечения миелодиспластических синдромов" —
• „Аллогенная трансплантации гемопоэтических стволовых клеток при МДС и апластической анемии“.
биология, патогенез, диагностика
Среди постерных сообщений по биологии МДС наибольший интерес, с нашей точки зрения, представляли доклады, посвященные исследованию профиля генов, которые могут быть вовлечены в патогенез заболевания, а также результатам иммунофенотипирования в диагностике МДС.
Известно, что у большинства пациентов с МДС костный мозг характеризуется гипер- или нормоклеточ-ностью и только у незначительной части обнаруживается гипоклеточный вариант заболевания, который может представлять диагностические (морфологические и цитогенетические) трудности. Выявление молекулярных аномалий может служить дифференциально-диагностическим критерием МДС и других гипопластических состояний костного мозга.
В связи с этим группой исследователей из США проведено исследование „Отличия геномных изменений при гипоклеточном и гипер-/нормоклеточном вариантах МДС“ (Distinct Pattern of Genomic Changes Associated with Hypoplastic Compared to Hyper/Normo-blastic Myelodysplastic Syndromes (MDS)) [A. Nazha et al. Abstract 4603]. Авторами осуществлен геномный анализ с помощью направленного секвенирования следующего поколения (NGS) 62 генов, выбранных на основании более высокой частоты их обнаружения в группе пациентов с МДС, которые были ранее проанализированы с помощью полного экзомного секвенирования (WES). Обнаруженные мутации могут гипотетически участвовать в патогенезе МДС.
В исследование было включено 237 больных МДС, 32 (14%) из которых характеризовались гипоплазией костного мозга. В отличие от гипер- и нормоклеточного вариантов МДС при гипопластическом отмечались статистически значимые более низкие показатели числа лейкоцитов (медиана 2,4 vs 3,7×109/л- p = 0,002), нейтрофилов (медиана 1,07 vs 1,67×109/л- p = 0,009) в крови и высокое число бластных клеток (6 vs 2%- p = 0,006) в костном мозге. Статистически значимые различия между другими признаками, включая цитоге-нетические аномалии при стандартном исследовании и показатели общей 3-летней выживаемости, не получены.
214
Тем не менее сравнение групп больных с гипер- и гипоклеточным МДС выявило существенные различия в частоте соматических мутаций генов. Так, мутации SF3B1 (3 os 17%- p = 0,02) и IDH½ (0 os 9%- p = 0,06) чаще наблюдались при гиперклеточном костном мозге, в то время как мутации DDX41/DDX54 (2 os 9%- p = 0,08) обнаруживались реже. Кроме того, патологический клон по числу мутаций генов был больше при гиперклеточном МДС (61,9 os 46,8%- p = 0,02). Набор мутаций SF3B1, SUZ12, ZRSR2, U2AF1, TET2, STAG2, ASXL1, BCOR и BCORL1 чаще выявлялся в качестве доминирующих клональных нарушений у пациентов с гипо- и гиперклеточным вариантами МДС. Таким образом, обнаруженные нарушения профиля экспрессии генов могут служить дополнительным диагностическим критерием МДС с гипо- и гиперплазией костного мозга.
Не меньшие диагностические трудности могут возникать при цитопении без очевидных доказательств МДС. Диагностика МДС базируется прежде всего на выявлении цитопении в сочетании с соответствующими диспластиче-скими признаками и клональным характером гемопоэза. Последний выражается в наличии типичных аномалий кариотипа. Следует отметить, что частота клональных соматических мутаций у пациентов с цитопенией без морфологических доказательств МДС неизвестна. Выявление нарушений кариотипа только при наличии цитопении может свидетельствовать о повышенном риске развития МДС.
В работе J. Hall и соавт. „Исследование соматических мутаций, указывающих на клональный характер гемопоэза, у значительной когорты пациентов с цитопе-нией и отсутствием диагностических критериев МДС“ (Somatic Mutations Indicative of Clonal Hematopoiesis Are Present in a Large Fraction of Cytopenic Patients Who Lack Diagnostic Evidence of MDS) [J. Hall et al. Abstract 3272] было сформировано три группы больных с цитопенией (верифицированный МДС [n = 8], с подозрением на МДС [n = 12] и с отсутствием МДС [n = 66]). Диагноз устанавливался на основании общепринятых методов: морфологического, цитогенетического, а также иммуно-фенотипического. У всех 86 больных (медиана возраста 71 год) осуществлен анализ мутаций 21 гена, связанного с МДС: SF3B1, SRSF2, U2AF1, ZRSR2, TET2, IDH1, IDH2, DNMT3A, EZH2, ASXL1, SETBP1, TP53, PHF6, RUNX1, ETV6, CBL, NRAS, KIT, JAK2, MPL, NPM1. В группе с отсутствием МДС обнаружены мутации генов TET2, ТР53, RUNX1, DNMT3A, SETBP1, ASXL1, ZRSR2. Различий в возрасте, показателях гемограммы у пациентов с мутациями и без них в этих группах сравнения не было.
Перечисленные мутации у лиц без верифицированного МДС могут представлять собой ранние этапы формирования данного заболевания при отсутствии каких-либо его клинических проявлений. В то же время эти мутации могут свидетельствовать об иных заболеваниях, влияющих на нормальное кроветворение, и быть охарактеризованы как „случайные“, которые наблюдаются у людей пожилого возраста. Представляет интерес, что в этом проспективном исследовании число больных без убедительных клинико-лабораторных симптомов МДС оказалось значительно меньше, чем тех, у кого присутствуют очевидные признаки болезни. Выявление
Клиническая онкогематология
этой группы пациентов (с обнаруженными мутациями генов) свидетельствует о том, что цитопения клонального характера может встречаться существенно чаще, чем при „классическом“ МДС.
Наблюдение за лицами с этим генетическим профилем может позволить определить вероятность развития МДС. Секвенирование и проведение дополнительных анализов у остальных 59 пациентов продолжаются.
Мутации в генах, которые в большинстве наблюдений являются МДС-ассоциированными, могут обнаруживаться у большинства пациентов с минимальными морфологическими признаками заболевания или без таковых.
Мнение о том, что обнаружение мутаций генов у больных с цитопенией представляет собой метод, подтверждающий диагноз МДС, разделяют F. Albitar и соавт. С их точки зрения, у пациентов с цитопенией необходимо исключать диагноз МДС. Для подтверждения МДС требуется морфологическая оценка аспирата и материала биопсии костного мозга, а также проведение цитогене-тического исследования. В ряде случаев морфологическое исследование может представлять существенные сложности, а отсутствие цитогенетических аберраций дополнительно затрудняет диагностику. Современные возможности позволяют определить молекулярные изменения, характерные для ранней диагностики МДС.
В постере „Глубокое секвенирование ДНК в плазме крови как надежный метод, подтверждающий диагноз МДС“ (Deep Sequencing of Peripheral Blood Plasma DNA As a Reliable Test for Confirming the Diagnosis of Myelodysplastic Syndrome) [F. Albitar et al. Abstract 1909] представлены соответствующие данные. С целью диагностики ранних вариантов МДС (число бластных клеток в костном мозге менее 5%) авторы публикации определяли диагностические возможности исследования внеклеточной ДНК в плазме методом NGS.
В работе изучались следующие гены: ASXL1, ETV6, EZH2, IDH1, ?DH2, NRAS, CBL, RUNX1, SF3B1, SRSF2, TET2, TP53, U2AF1 и ZRSR2.
Глубокое секвенирование внеклеточной ДНК в плазме 16 пациентов с ранними вариантами МДС выявило наличие одной или нескольких мутаций генов, что подтверждало диагноз МДС. У 3 (19%) пациентов была идентифицирована мутация 1 гена, у остальных 13 (81%) — 2 генов и более. В группе здоровых доноров (n = 4) исследование внеклеточной ДНК в плазме не выявило мутаций генов. NGS позволило оценить относительную опухолевую нагрузку в плазме. Она была значимо выше, чем при секвенировании внутриклеточной ДНК (p = 0,008), что может указывать на большую чувствительность первого метода, в т. ч. для определения минимальной остаточной болезни.
NGS внеклеточной ДНК у пациентов с цитопенией представляет собой метод, подтверждающий диагноз МДС. Кроме того, анализ мутаций внеклеточной ДНК позволяет выявить отдельные субклоны и возникновение новых клонов опухолевых клеток.
Обращает на себя внимание различие в трактовке результатов, полученных в этом и указанном выше исследованиях, в которых авторы не столь категоричны во мнении об МДС-ассоциированных генах.
Для определения значения мутаций генов в патогенезе МДС проведено крупное исследование „Диагно-
www. medprint. ru
стические возможности секвенирования следующего поколения в выявлении больных с профилем мутаций генов, соответствующим МДС низкого риска, при идио-патической цитопении неопределенного значения“
(Next-Generation Sequencing (NGS)-Based Profiling of Idiopathic Cytopenia of Undetermined Significance (ICUS) Identifies a Subset of Patients with Genomic Similarities to Lower-Risk Myelodysplastic Syndrome (MDS)) [B. Kwok et al. Abstract 166]. Термин „идиопатическая цитопения неопределенного значения“ (ICUS) применяется для описания нарушений кроветворения, сопровождающихся длительной необъяснимой цитопенией без минимальных признаков МДС. В связи с незначительным числом исследований ICUS концепция развития ранней предфазы МДС у некоторых больных не вызывает сомнения, поскольку в дальнейшем может наблюдаться развернутая картина МДС или острый миелоидный лейкоз (ОМЛ). У большинства пациентов с МДС выявляется не менее 1 соматической мутации „водительских“ (регуляторных) генов с РНК-сплайсингом и нарушением эпигенетических сигнальных путей.
Авторами проведено секвенирование ДНК с целью изучить мутации генов SF3B1, SRSF2, U2AF1, ZRSR2, TET2, IDH1, IDH2, DNMT3A, EZH2, ASXL1, SETBP1, TP53, PHF6, RUNX1, ETV6, CBL1, NRAS, KIT, JAK2, MPL и NPM1. В исследование включено 250 пациентов с ICUS и 90 больных с МДС низкого риска. У 82 (33%) из 250 пациентов с ICUS идентифицировано не менее 1 соматической мутации генов. В этой группе больных (ICUS-MUT) среднее число мутаций составило 1,8 на 1 больного. Мутация TET2, ранняя генетическая аномалия, определялась в 38% наблюдений. Мутация DNMT3A выявлена у 20% пациентов, ASXL1 — у 18%, SRSF2 — у 15% и ZRSR2 — у 11%. Остальные мутации встречались менее чем в 10% случаев. Наиболее часто в процессе патогенеза участвовали эпигенетические регуляторы и белки, ответственные за сплайсинг РНК. Статистически значимых различий по таким показателям, как медианы уровня гемоглобина, абсолютного числа нейтрофилов и числа тромбоцитов, между группами ICUS-MUT и ICUS дикого типа (ICUS-WT) не было. Единственные различия были в том, что в группе ICUS-MUT преобладали более пожилые пациенты (78 vs 69 лет- p & lt- 0,0001) и мужчины (соотношение мужчины/женщины 1,3:1 vs 0,8: 1- p = 0,0139).
При МДС низкого риска 1 мутация и более определялась у 75 (83%) из 90 пациентов, среднее число мутаций (как и в группе ICUS-MUT) составило 1,8 на 1 больного. Мутация SF3B1 была характерна (47%) для МДС с кольцевыми сидеробластами. Частота мутаций генов ASXL1, TET2 и DNMT3A составила 16, 14 и 10% соответственно. Остальные мутации встречались менее чем в 10% наблюдений. Частота эпигенетических нарушений и РНК-сплайсинга составила 65 и 18%. Различия между медианами абсолютного числа нейтрофилов и числа тромбоцитов, возрастом и полом в группах ICUS-MUT и МДС низкого риска отсутствовали. Единственное значимое различие — более низкий уровень гемоглобина в группе МДС низкого риска (97 vs 105 г/л- p = 0,0058).
Вероятно, в связи с несопоставимостью по числу больных МДС и ICUS, а также одинаковым средним числом мутаций на 1 пациента различия в частоте мутаций (83 vs 33%) не включались в статистический
215
Рис. 1. Перекрестные синдромы [L. Pleyer, D. Neureiter, R. Greil. Clonal Bone Marrow Failure Overlap Syndromes. In: Chronic Myeloid Neoplasias and Clonal Overlap Syndromes. Epidemiology, Pathophysiology and Treatment Options. Ed. by R. Greil, L. Pleyer et al. Wien, New York: Springer, 2010. pp. 281−8. ISBN: 978−3-211−79 891−1 (Print) — 978−3-211−79 892−8 (Online)]
АА — апластическая анемия- ОМЛ — острый миелоидный лейкоз- ПНГ — пароксизмальная ночная гемоглобинурия- Т-БГЛ — Т-клеточная лимфома из больших гранулярных лимфоцитов.
Fig. 1. Overlap syndromes [L. Pleyer, D. Neureiter, R. Greil. Clonal Bone Marrow Failure Overlap Syndromes. In: Chronic Myeloid Neoplasias and Clonal Overlap Syndromes. Epidemiology, Pathophysiology and Treatment Options. Ed. by R. Greil, L. Pleyer et al. Wien, New York: Springer, 2010. pp. 281−8. ISBN: 978−3-211−79 891−1 (Print) — 978−3-211−79 892−8 (Online)]
АА — aplastic anemia- ОМЛ — acute myeloid leukemia- ПНГ — paroxysmal nocturnal hemoglobinuria- Т-БГЛ — T-cell large granular lymphocyte lymphoma.
анализ. Таким образом, метод NGS позволил обнаружить соматические мутации генов у 33% больных ICUS, что указывает на потенциальную возможность развития у них предфазы МДС.
Отдельный интерес представляют публикации, посвященные вопросу биологии перекрестных миелоидных опухолей, часть из которых раньше обозначалась термином „перекрестные синдромы“ (overlap syndromes). Кроме того, под перекрестными синдромами подразумевались наблюдения апластической анемии с признаками дисплазии и МДС с гипоплазией костного мозга, парок-сизмальная ночная гемоглобинурия, МДС и др. (рис. 1).
M. Meggendorfer и соавт. в сообщении „Различия, обнаруживаемые при молекулярном анализе между перекрестными МДС/МПО по классификации ВОЗ“ (Molecular Analyses of MDS/MPN Overlap Entities According to WHO Classification Reveal a Distinct Molecular Pattern for MDS/MPN, Unclassifiable) [M. Meggendorfer et al. Abstract 4618] предприняли попытку провести более четкую границу между перекрестными миелоидными опухолями.
В классификации ВОЗ миелодиспластические/ миелопролиферативные опухоли (неоплазии), т. е. МДС/ МПО, выделены в отдельную группу заболеваний на основании клинических, морфологических и ряда лабораторных признаков, указывающих как на МДС, так и МПО. Эти злокачественные опухоли системы крови включают атипичный хронический миелолейкоз (аХМЛ), хронический миеломоноцитарный лейкоз (ХММЛ), МДС/МПО неклассифицируемую (МДС/МПО-Н), рефрактерную анемию с кольцевыми сидеробластами, сопровождающуюся выраженным тромбоцитозом (РАКС-Т). В последние годы в понимание биологии РАКС-Т, ХММЛ и аХМЛ внесена большая ясность в результате проведения ряда молекулярных исследований.
В исследование было включено 179 больных с диагнозами МДС/МПО: аХМЛ (n = 35), ХММЛ (n = 58),
216
МДС/МПО-Н (n = 39) и РАКС-Т (n = 47). Всем больным проведен мутационный анализ генов ASXL1, TET2, DNMT3A, SRSF2, SF3B1, U2AF1, JAK2, CALR, MPL, NRAS, KRAS, CBL, BRAF, CSF3R, RUNX1, SETBP1 и NPM1. Стандартный цитогенетический анализ выполнен в 172 из 179 наблюдений. Группу с нормальным карио-типом составили 128 (74%) пациентов, с аномальным — 44 (26%).
В общей группе больных наиболее часто выявлялись мутации генов ASXL1 (41%) и TET2 (40%), а также генов сплайсосомы (большой комплекс, состоящий из РНК и белков) SF3B1 (31%) и SRSF2 (30%). Часто обнаруживались мутации JAK2 (21%), NRAS (15%), RUNX1 (12%) и CBL (12%). Мутации других генов отмечены менее чем в 10% наблюдений.
Мутация ASXL1 при РАКС-Т обнаружена с частотой 19%, а при аХМЛ — 60% (p & lt- 0,001), в то время как при ХММЛ она выявлялась у 52% пациентов (p = 0,001). Мутация гена TET2 чаще наблюдалась при ХММЛ (53%), чем при МДС/МПО-Н (26%- p = 0,007) и РАКС-Т (32%- p = 0,031). Частота мутации SRSF2 была выше у больных ХММЛ (53%), чем у пациентов с РАКС-Т (9%- p & lt- 0,001) и МДС/МПО-Н (15%- p & lt- 0,001). Мутация SF3B1 чаще идентифицировалась при РАКС-Т (92%), чем при других МДС/МПО (p & lt- 0,001): аХМЛ (11%), ХММЛ (5%), МДС/МПО-Н (13%). Важное отличие обнаружено между группами аХМЛ и ХММЛ vs МДС/ МПО-Н и РАКС-Т. Оно заключается в нарушениях двух различных сигнальных путей:
1) путь JAK/STAT (JAK2/CALR/MPL) был со статистически более высокой частотой изменен при МДС/ МПО-Н (33%) и РАКС-Т (53%) по сравнению с группой аХМЛ и ХММЛ (9 и 7% соответственно- p & lt- 0,001) —
2) путь RAS (NRAS/KRAS/CBL) был чаще нарушен при аХМЛ (37%) и ХММЛ (52%) по сравнению с МДС/ МПО-Н и РАКС-Т (5 и 9% соответственно- p & lt- 0,001).
Авторы работы делают заключение:
Клиническая онкогематология
Рис. 2. Молекулярные аномалии и результаты цитогенетического исследования при миелодиспластических синдромах/миелопро-лиферативных опухолях. Красный цвет — мутация гена- оранжевый — комбинации мутаций гена- серый — отсутствие мутации/ нормальный кариотип- черный — аномальный кариотип- белый — анализ не проводился
Fig. 2. Molecular abnormalities and results of cytogenetic tests in myelodysplastic syndromes/myeloproliferative tumors. Red — gene mutations- orange — combinations of gene mutations- grey — absence of mutations/normal karyotype- black — abnormal karyotype- white — no analysis was performed
1) мутации генов ASXL1 и TET2 являются наиболее частыми в общей группе больных с перекрестными МДС/ МПО-
2) мутация SF3B1 специфична для РАКС-Т-
3) мутация SRSF2 чаще обнаруживается у больных ХММЛ и аХМЛ-
4) в патогенезе МДС/МПО-Н важную роль играют мутации всех генов сплайсосомы-
5) нарушение сигнального пути JAK/STAT наиболее часто обнаруживается при МДС/МПО-Н и РАКС-Т-
6) нарушение сигнального пути RAS чаще встречается при аХМЛ и ХММЛ-
7) при МДС/МПО-Н наблюдаются молекулярные нарушения, характерные для всех вариантов МДС/МПО.
Результаты проведенного исследования представлены на рис. 2.
Исследователи из Германии представили результаты сопоставления профиля мутаций генов у больных с del (5q), в т. ч. при перекрестных миелоидных опухолях, в работе „Делеции 5q при МДС и миелопролиферативных опухолях: мутация на молекулярном уровне и формирование фенотипа у больных со смешанными (перекрестными) МПО, МДС, МПО/МДС (неоплазиями)“ (5q Deletions in MDS and MPN: The Accompanying Molecular Mutations Determine the Phenotype but TP53 Is Frequently Mutated in All Entities: MPN, MDS and MPN/ MDS Overlap) [C. Haferlach et al. Abstract 1926].
Делеция 5q относится к характерным (повторяющимся) цитогенетическим аномалиям. Она может диагностироваться как единственная аномалия кариотипа либо в сочетании с дополнительными хромосомными аберрациями при:
1) миелодиспластических синдромах (МДС) —
2) миелопролиферативных опухолях (МПО) —
3) миелодиспластических/миелопролиферативных опухолях (неоплазиях) (МДС/МПО).
Цитогенетический анализ проведен у 97, 1869 и 37 пациентов соответственно. При обнаружении del (5q) материал был исследован на молекулярном уровне: МПО (n = 24) и МДС/МПО (n = 19). В качестве контрольной группы рассматривались данные 48 больных МДС с изолированной del (5q). Набор генов, типичных для миелопролиферативных неоплазий, включал ASXL1, BCOR, BRAF, CBL, DNMT3A, ETV6, EZH2, FLT3-TKD, GATA1, GATA2, IDH1, IDH2, JAK2, KIT, KRAS, MPL, NPM1, NRAS, PHF6, RUNX1, SF3B1, SRSF2, TET2, TP53, U2AF1 и WT1. Исключение составил ген RUNX1, который исследовался отдельно.
Частота делеции 5q была выше при МДС (16,4% всех наблюдений МДС), что составило 37,8% случаев с этим заболеванием и аномальным кариотипом по сравнению с МДС/МПО (3,3 vs 11,6%) и МПО (1,5 vs
7.1%) соответственно. Частота del (5q) в составе сложного кариотипа была сопоставима между изучаемыми заболеваниями (МДС — 41,4%, МДС/МПО — 45,9%, МПО — 43,3%).
Результаты секвенирования показали, что частота мутаций в целом имеет место у 78 из 91 пациента. Среднее число мутаций генов у одного пациента составило 1,6 в группе МДС/МПО, 1,5 — в группе МПО и
1.2 — в группе МДС. Во всех подгруппах с наибольшей частотой наблюдалась мутация TP53 и составила для общей когорты 30,8%. Кроме того, в общей группе больных частота мутации SF3B1 была 13,2%, а TET2 и ASXL1 — по 11%. Различий в частоте мутаций рассматриваемых 3 генов не наблюдалось между МПО, МДС и МДС/МПО (SF3B1 — 8,3, 18,8 и 5,3%- TET2 — 12,5, 16,7 и 5,3%- ASXL1 — 12,5, 8,3 и 15,8%). Следует отметить, что мутации ASXL1, а также TP53, SF3B1 и DNMT3A были взаимоисключающими. Мутация JAK2 V617 °F присутствовала в общей когорте в 28,6% наблюдений: при МПО (58,3%) и МДС/МПО (47,4%), а при МДС — только 6,3% (p & lt- 0,0001).
?. medprint. ru
217
Мутация DNMT3A была обнаружена у 18,7% пациентов- представляется важным, что наиболее часто она имела место при МДС (27,1%), при МДС/МПО — 10,5% и МПО — 8,3% (p = 0,034). У пациентов с мутациями ASXL1, JAK2, TET2 и TP53 наблюдалась по крайней мере одна дополнительная мутация. Менее чем в 5% случаев были обнаружены мутации генов BCOR, CBL, EZH2, FLT3-TKD, GATA2, KRAS, MPL, NRAS, RUNX1, SRSF2 и U2AF1. Мутаций генов ETV6, GATA1, IDH1, IDH2, KJT, NPM1, PHF6 и WT1 не выявлено.
Исследователи делают заключение о том, что:
1) у пациентов с del (5q) и МПО, МДС или МДС/ МПО имелось не менее одной молекулярной мутации в 85,7% наблюдений-
2) мутация TP53 часто отмечалась у пациентов с del (5q) независимо от заболевания-
3) мутация генов JAK2, SF3B1, TET2 и ASXL1 наблюдалась с частотой более 10%-
4) мутация JAK2 V617 °F наиболее часто встречается при МПО и МДС/МПО, а мутация DNMT3A наиболее характерна для МДС.
Влияние мутаций генов на выживаемость больных МДС с делецией 5q было изложено в работе М. Meg-gendorfer и соавт. „Широкий спектр клинически значимых мутаций при МДС с изолированной del (5q): результаты исследования 26 генов у 119 пациентов“ (Molecular Analysis of Myelodysplasie Syndrome with Isolated Del (5q) Reveals a Broad Spectrum of Clinically Relevant Mutations: A Study on 119 Patients and 26 Genes) [M. Meggendorfer et al. Abstract 4608].
Цель настоящей работы — определить частоту мутаций 26 генов и исследовать мутационный статус генов применительно к факторам прогноза.
В исследование было включено 119 больных (85 женщин и 34 мужчины) с вариантом МДС с изолированной делецией 5q. Всем пациентам был выполнен анализ мутаций генов ASXL1, BCOR, BRAF, CBL, DNMT3A, ETV6, EZH2, FLT3-TKD, GATA1, GATA2, IDH1, IDH2, JAK2, KIT, NRAS, KRAS, MPL, NPM1, PHF6, RUNX1, SF3B1, SRSF2, TET2, TP53, U2AF1 и WT1. У большинства констатирована 1 мутация (60 из 119, 50%) — 2, 3 и 4 мутации у одного пациента обнаруживались реже (соответственно 18 из 119, 15%- 2 из 119, 2%- 1 из 119, 1%). В общей когорте больных наиболее часто наблюдались мутации генов DNMT3A и TP53 (21 из 119, у 18% в каждой группе), SF3B1 (20 из 119, 17%), TET2 (14 из 119, 12%), ASXL1 (9 из 119, 8%), а также JAK2 (7 из 119, 6%).
Несмотря на то что мутации этих 6 генов редко формировали своеобразный „перекрест“, они не были полностью взаимоисключающими. Чаще наблюдалась мутация одного из этих генов. Частота мутаций других проанализированных генов составила менее 5%. Распределение пациентов по группам согласно прогностической шкале IPSS-R относительно числа бластных клеток в костном мозге менее 2 и 2−5% не позволило выявить корреляцию с числом мутаций генов у пациентов, включенных в данную выборку.
Различия между этими двумя группами в числе лейкоцитов и тромбоцитов отсутствовали. Мутации TP53 и SF3B1 коррелировали со старшим возрастом (78 os 73 лет, p = 0,047- 78 os 73 лет, p = 0,050 соответственно).
218
Корреляционный анализ числа кольцевых сидеробла-стов (& gt- 15%) и мутации SF3B1 показал, что и при МДС с изолированной del (5q) эти два показателя значимо коррелируют со средним числом кольцевых сидеробластов 19% (диапазон 0−80%). Обращает на себя внимание тот факт, что у пациентов с мутацией SF3B1 общая выживаемость была значимо хуже, чем у пациентов с обнаружением гена SF3B1 дикого типа (медиана общей выживаемости 31 vs 91 мес.- p = 0,008).
Кроме того, отмечалась более высокая частота мутации TP53 при МДС с изолированной del (5q) по сравнению с другими вариантами МДС: 21 (18%) из 119 наблюдений в сравнении с 49 (6%) из 781 (p & lt- 0,001). Тем не менее авторы этого исследования не обнаружили прогностической значимости мутации гена TP53. Медиана общей выживаемости в этой группе составила 91 мес.
Следует отметить, что 60 (50%) из 119 пациентов, включенных в исследование, находились под наблюдением и получали трансфузии эритроцитов или только эритропоэтин. Увеличение количества мутаций генов было связано с отчетливой тенденцией к неблагоприятному прогнозу (медиана общей выживаемости 90 vs 36 мес.- p = 0,061).
Таким образом:
1) мутация ТР53 наиболее часто обнаруживается при МДС с изолированной del (5q) —
2) число кольцевых сидеробластов более 15% коррелирует с мутацией SF3B1-
3) мутация SF3B1 связана с более низкими показателями общей выживаемости-
4) увеличение количества мутаций имеет отрицательное прогностическое значение.
Помимо молекулярных исследований на конгрессе были представлены сообщения, посвященные роли иммунофенотипирования в диагностике МДС. Дифференциальная диагностика цитопении при МДС и неклональных (неопухолевых) заболеваниях может представлять сложную проблему, особенно в случаях с минимальными признаками дисплазии и отсутствием специфичных для МДС цитогенетических аберраций. Современные рекомендации по диагностике МДС также включают проточную цитометрию.
Th.M. Westers и соавт. представили результаты международного исследования в докладе „Применение иммунофенотипирования с целью обнаружить дис-плазию клеток эритроидного ряда в диагностике МДС. Доклад Европейской рабочей группы по проточной цитометрии (LeukemiaNet-МВМС-Flow)“ (Diagnostic Application of Immunophenotypic Analysis of Erythroid Dysplasia in Myelodysplastic Syndromes. A Report on Behalf of the European LeukemiaNET-IMDS-Flow Cytometry Working Group) [Th.M. Westers et al. Abstract 1914].
В большинстве случаев субстратом изучения при проточной цитометрии служат клетки-предшественницы и клетки миеломоноцитарного происхождения разных этапов дифференцировки. Изучение иммунофенотипиче-ских особенностей эритрокариоцитов методом проточной цитометрии может иметь дополнительное диагностическое значение. В настоящем сообщении приведены результаты многоцентрового исследования, осуществляемого Европейской рабочей группой LeukemiaNet MDS-FC (ELNET-МВМС — Flow) по определению характеристик эритроидных клеток, которые позволяют
Клиническая онкогематология
дифференцировать клональный дизэритропоэз, обусловленный МДС, от такового при цитопении неклональной природы.
Анализ был основан на принципах проведения проточной цитометрии ЕЬЫЕТ-МВМС для ядросодержащих эритроидных клеток (исследование экспрессии CD117, CD71, CD36, CD235a и CD105). Результаты проточной цитометрии клеток эритроидного ряда костного мозга были получены преимущественно у больных МДС низкого риска, пациентов с другими заболевания системы крови и у здоровых лиц.
В исследование были включены больные МДС (п = 403), здоровые доноры (п = 191), больные с не-клональными заболеваниями системы крови (п = 443). Анализ показал, что экспрессия CD71 и CD36 эритроцд-ными клетками в сочетании с процентным содержанием CD117+ эритроидных клеток-предшественниц позволяют максимально точно провести границу между МДС и цитопенией неклонального происхождения. Перечисленные маркеры были использованы для диагностики дисплазии эритроидных клеток посредством проточной цитометрии с чувствительностью метода 59% (95%-й доверительный интервал [95% ДИ] 49−68%) и специфичностью 84% (95% ДИ 77−89%). Следует отметить, что проточная цитометрия позволила не у всех пациентов с МДС обнаружить дисплазию эритрокариоцитов, в то время как она определялась при некоторых неклональных процессах.
Оценка результатов проточной цитометрии эритроидных клеток с признаками дисплазии продемонстрировала специфичность 77% (95% ДИ 29−50%) и чувствительность 39% (95% ДИ 66−85%) для разграничения пациентов с МДС и с неклональными заболеваниями системы крови. В группе с неклональными заболеваниями системы крови и диспластическими изменениями (только по результатам проточной цитометрии) отмечались реактивные состояния гемопоэза и цитопении, связанные с инфекциями. У большинства больных с признаками дисплазии гемопоэза (по данным проточной цитометрии) из контрольной группы была обнаружена аномальная экспрессия CD71. Этот факт указывает на то, что аномальной экспрессии 1 антигена недостаточно для диагностики дисплазии. Только аберрантная экспрессия нескольких антигенов может указывать на диспластические изменения клеток эритроидного ростка со специфичностью 96 и 95%, однако при существенно сниженной чувствительности (37 и 21% соответственно) в сравниваемых когортах больных.
Таким образом, анализ эритроидных и миелоидных ростков гемопоэза должен проводиться одновременно с целью повысить чувствительность и специфичность метода. В заключение авторы делают вывод о том, что сочетание определенных эритроидных маркеров с одновременной оценкой методом проточной цитометрии клеток-предшественниц и созревающих элементов мие-ломоноцитарного происхождения может способствовать диагностике МДС.
Проточная цитометрия используется в дополнение к цитоморфологическому методу для оценки диспластиче-ских изменений наряду с рутинными цитогенетическими данными („золотой стандарт“). К настоящему времени числовые системы проточной цитометрии при МДС характеризуются средней чувствительностью и специ-
www. medprint. ru
фичностью около 71 и 93% соответственно. Они основаны на анализе миелоидного и моноцитарного ростков гемопоэза. Исследовательская группа HOVON89 также предположила, что изучение клеток эритроидного ростка может увеличить чувствительность метода проточной цитометрии при МДС. Результаты проведенной работы опубликованы в постере „Анализ клеток эритроидного ростка с помощью проточной цитометрии — важный дополнительный метод диагностики МДС: исследование группы HOVON89“ (Erythroid Lineage Analysis By Flow Cytometry Is of Highly Additive Value for MDS Diagnosis: A Study on Behalf of the HOVON89 Study Group) [E.M. Cremers et al. Abstract 4667].
Проанализировано 176 аспиратов костного мозга методом проточной цитометрии у 110 больных МДС (низкого и промежуточного-1 риска) и у 66 пациентов из контрольной группы (с дефицитом железа, болезнями накопления железа, дефицитом витамина В12, цитопе-нией в результате приема лекарственных средств или хронических заболеваний, с апластической анемией и пароксизмальной ночной гемоглобинурией).
Для исследования клеток эритроидного ростка использовались маркеры, рекомендованные Европейской группой ELNet iMDS-Flow, например уровень экспрессии CD71 и CD36, а также число (%) клеток-предшественниц эритропоэза (CD117+ или CD105+). Первоначальный анализ результатов проточной цитометрии показал, что из 110 пациентов с доказанным МДС 75 относятся к категории „согласующихся с МДС“ (истинно положительной), 23 — к „аберрациям, незначительно связанным с МДС“, а 12 — к „не согласующимся с МДС“ (ложноотрицательным) наблюдениям. В контрольной группе 45 из 66 пациентов соответствовали категории „не согласующихся с МДС“ (истинно отрицательной), 20 из 66 наблюдений были отнесены к „аберрациям, незначительно связанным с МДС“, 1 из 66 — к категории „согласующихся с МДС“ (ложноположительной). Чувствительность и специфичность проточной цитометрии при МДС без анализа клеток эритроидного ростка составили 68 и 98% соответственно.
Метод проточной цитометрии эритроидного ростка показал наличие выраженного дизэритропоэза у 82 из 110 больных МДС, в то время как он присутствовал у 16 из 66 участников контрольной группы (с другими заболеваниями системы крови). Имела место отчетливая корреляция между дизэритропоэзом при проточной цитометрии и морфологическим диагнозом (коэффициент Пирсона R = 0,71- p & lt- 0,001).
Объединение этих данных с числовой системой проточной цитометрии при МДС продемонстрировало, что из 110 больных МДС у 94 была установлена категория „согласующихся с МДС“, у 13 — „аберрации, незначительно связанные с МДС“ и у 3 — „не согласующихся с МДС“. В контрольной группе из 66 пациентов 40 охарактеризованы как „не согласующиеся с МДС“, 23 — с „аберрациями, незначительно связанными с МДС“, 3 — как „согласующиеся с МДС“.
Таким образом, объединение результатов проточной цитометрии клеток эритроидного ряда с числовой системой проточной цитометрии при МДС позволило увеличить чувствительность до 85% и незначительно снизить специфичность метода (95%).
219
Кроме того, на конгрессе ASH-2014 рассматривались иммунофенотипические особенности некоторых подвариантов МДС и ОМЛ, например с моносомией хромосомы 7, которая является цитогенетическим фактором неблагоприятного прогноза. МДС и ОМЛ с -7 и/или 7q- могут быть объединены термином „опухоли (неоплазии) миелоидного происхождения из стволовых клеток“ (ОМСК). Иммунофенотипирование относится к одному из методов выявления опухолевых бластных клеток миелоидного происхождения. Следует отметить, что иммунофенотипические особенности ОМСК с моно-сомией 7 и/или del (7q) ранее не были описаны.
В работе „Иммунофенотипические признаки миелоидных опухолей стволовоклеточного происхождения с моносомией хромосомы 7“ (Immunophenotypic Features of Myeloid Stem Cell Neoplasms Associated with Monosomy 7) [X. Chen, S. Cherian. Abstract 1051] ретроспективно проанализированы результаты и обобщены данные проточной цитометрии у этой категории пациентов.
У 126 больных ОМСК были идентифицированы моносомия хромосомы 7 и делеция 7q как изолированные аномалии кариотипа либо в сочетании с другими цитоге-нетическими аберрациями. В исследование были включены пациенты с моносомией хромосомы 7 (n = 112) и делецией 7q (n = 73), у которых определялись миело-моноцитарные клетки, соответствующие требованиям проведения проточной цитометрии.
Повышение экспрессии CD14 (компонент рецептор-ного комплекса CD14/TLR4/MD2) на мембране миелоидных клеток обнаружено у 86 (77%) больных с моно-сомией хромосомы 7. Кроме того, выявлено увеличение других разновидностей аномального иммунофенотипа, в т. ч. на миелобластах (медиана 7,3%, диапазон 0−54%), и числа бластных клеток без признаков дифференцировки (CD34+/CD38-). Обнаружена аберрантная экспрессия CD5 (22%), CD7 (72%), CD13 (48%), CD15 (19%), CD33 (50%), CD34 (37%), CD38 (57%), CD56 (41%), CD117 (54%), HLA-DR (59%) на миелоидных бластных клетках и аномальная экспрессия CD56 (43%) и CD64 (54%) на миелоидных клетках с признаками созревания. Идентифицирована аберрантная экспрессия CD56 моноцитами (41%).
Следует отметить, только у 6 (8%) больных с делецией 7q отмечено увеличение экспрессии CD14 на миелоидных клетках с признаками созревания. Результаты проточной цитометрии были оценены у 10 больных с признаками регенерации костного мозга (день +28 после завершения химиотерапии или после выполнения трансплантации). При этом ни в одном из наблюдений не отмечалось увеличения экспрессии CD14 на миелоидных клетках с признаками созревания. Как сообщалось ранее, у 10 из 15 больных, получавших гранулоцитарный колониести-мулирующий фактор, было продемонстрировано повышение экспрессии CD14+ на клетках миелоидного ряда кроветворения без других аномалий иммунофенотипа.
Полученные данные свидетельствуют о том, что у пациентов с ОМСК моносомия хромосомы 7 связана с характерным иммунофенотипическим профилем, включающим увеличение экспрессии CD14 на созревающих клетках миелоидного ростка, в т. ч. и на бластных. В свою очередь, аномальный иммунофенотип может способствовать выявлению больных с моносомией 7 в опухолевых
220
клетках даже при нормальном числе бластных клеток миелоидного происхождения.
К другому направлению изучения биологии МДС относится определение роли микроРНК, нарушения ряда сигнальных путей и дисфункции васкулярной ниши в патогенезе заболевания. Группа исследователей из Италии представила сообщение, посвященное этой проблеме, „Аномальный профиль экспрессии микроРНК и продукция цитокинов в васкулярной нише при МДС“ (Abnormal MiRNA Expression Profile and Cytokine Production in Myelodysplastic Vascular Niche) [M. Martini et al. Abstract 1890].
Васкулярная ниша костного мозга играет важную роль в обеспечении пролиферации и дифференцировки гемопоэтических стволовых клеток (ГСК). В работе использовались циркулирующие эндотелиальные ко-лониеобразующие клетки (ECFC), полученные у пациентов с МДС низкого риска и здоровых доноров в качестве суррогата васкулярной ниши. Ранее было показано, что у больных МДС нарушено взаимодействие между эндотелиальными и гемопоэтическими клетками. Молекулярные исследования при МДС выявили, что у ECFC имеется гиперметилирование промоторов генов pl5INK4b, DAPK1, CDHl и SOCS1, а также нарушенный профиль экспрессии генов, ответственных за сигнальные пути адгезии, ангиогенеза, выживаемости и апоптоза. Кроме того, было продемонстрировано, что при МДС сигнальный путь Wnt (в частности, Wnt3 и Wnt5), который относится к одному из основных в регуляции межклеточного взаимодействия в кроветворной ткани, был нарушен при МДС по сравнению со здоровыми донорами. В нормальных условиях ECFC регулируют кроветворение посредством аутокринной и/или паракринной секреции различных растворимых медиаторов: факторов роста, цитокинов и хемокинов.
В настоящей работе исследовалась их продукция ECFC при МДС. Поскольку высвобождение ангиогенных факторов из микрососудов костного мозга регулируется микроРНК, в исследовании был определен профиль экспрессии 84 микроРНК, в т. ч. факторов, влияющих на сигнальный путь Wnt.
В совместных культурах ECFC с нормальными гемо-поэтическими клетками и гемопоэтическими клетками при МДС уровень нескольких растворимых медиаторов существенно отличался. В частности, в совместных культурах ECFC с гемопоэтическими клетками при МДС наблюдалась большая продукция интерлейкинов (IL-1b, IL-5, IL-13) и эндотелиального фактора роста сосудов (VEGF) (p & lt- 0,05). С другой стороны, IL-6, IL-10, IL-8 и RANTES (хемокин, выделяемый T-клетками при активации) продуцировались в меньшем количестве в совместных культурах с гемопоэтическими клетками при МДС (p & lt- 0,05). Эти растворимые медиаторы обладают плейотропным свойством и оказывают влияние (непосредственно или косвенно) на клеточную адгезию, диффе-ренцировку, выживаемость и ангиогенез. Авторы также отметили, что нарушение их продукции констатировано в совместных культурах всех трех линий дифференцировки миелопоэза, но было более выражено в мегакариоци-тарном и гранулоцитарном ростках, чем в эритроидном. Кроме того, изучение совокупности микроРНК показало, что при МДС ECFC содержат статистически значимо меньшее количество микроРНК- 142−3p, микроРНК-
Клиническая онкогематология
424−5p и микроРНК-196b-5p (p = 0,003, p = 0,001 и p = 0,033 соответственно). Эти микроРНК по-разному участвуют в кроветворении и ангиогенезе.
Учитывая, что добавление Wnt3 и Wnt5 в культуры только частично восстанавливало нормальную дифферен-цировку гемопоэтических клеток, аномальная секреция растворимых медиаторов, а также нарушенная экспрессия микроРНК могут вызывать дисфункцию васкулярной ниши и в результате приводить к возникновению МДС.
По данным J.C. Lam и соавт., важную роль в патогенезе МДС с del (5q) играют микроРНК-143 и микроРНК-145. Результаты проведенного исследования изложены в сообщении „Утрата микроРНК-143 и микроРНК-145 подавляет самообновление гемопоэтических стволовых клеток посредством нарушения регуляции сигнального пути TGF-в“ (Loss of MiR-143 and MiR-145 Inhibits Hematopoietic Stem Cell Self-Renewal through Dysregulated TGFe Signaling) [J.C. Lam et al. Abstract 527]. Наиболее распространенное нарушение кариотипа при МДС — интерстициальная делеция длинного плеча хромосомы 5 [del (5q)]. Этот вариант заболевания обозначается как синдром 5q-. Картирование хромосом показало, что обычно утрачиваемая область (commonly deleted region — CDR) при синдроме 5q- выявлена в регионе 5q32 и составляет 1,5 Mb. МикроРНК (miR)-143 и -145 располагаются в CDR del (5q) у больных МДС и вовлечены в патогенез заболевания. Однако их функция изучена недостаточно.
С целью изучить роль микроРНК-143 и -145 было использовано направленное изменение генов мышей с делециями miR-143 и miR-145. Исследователи показали, что костный мозг мышей, лишенных miR-143 и miR-145, характеризуется снижением числа ГСК и клеток-предшественниц миелоидной природы. С этой целью использовался метод проточной цитометрии и анализ активности гемопоэтических клеток-предшественниц при культуральном исследовании. Кроме того, авторами проведено предельное (лимитирующее) разбавление проб miR-143 и miR-145 костного мозга при МДС, в результате которого наблюдалась значительно меньшая функциональная активность ГСК по сравнению с клетками костного мозга дикого типа. В результате был идентифицирован сигнальный путь трансформирующего фактор роста-в (TGF-в) в качестве общей мишени для указанных выше микроРНК. Исследовательская группа подтвердила, что адаптерный белок DAB2 представляет собой мишень для микроРНК-145. Была отмечена активация сигнального пути TGF-в в связи с утратой микроРНК-145 или повышенная экспрессия DAB2.
При МДС с del (5q) утрата микроРНК-143 и микроРНК-145 приводит к нарушению активности ГСК. Кроме того, сигнальный путь TGF-в находится в активированном состоянии в костном мозге больных МДС, поэтому необходима оценка роли DAB2 как самостоятельной мишени для miR-145. В этом сообщении приводится обоснование того, что дефект miR-143 и miR-145, наблюдаемый в костном мозге, частично опосредуется DAB2 и в конечном итоге приводит к дефекту самообновления ГСК и возникновению МДС.
также определить прогноз при использовании различных препаратов и программ лечения. В связи с этим раздел „Прогноз“ распространяется и на рубрику „Лечение“.
К настоящему времени в качестве наиболее распространенных прогностических числовых (балльных) систем можно рассматривать IPSS — международную систему оценки прогноза у больных МДС, IPSS-R — модифицированную международную систему оценки прогноза у больных МДС и WPSS — прогностическую систему, адаптированную к классификации ВОЗ.
IPSS-R была разработана на основании анализа данных больных, ранее не получавших лечения.
A. Nazha и соавт. предложили новую прогностическую модель (систему) вне зависимости от предшествующего лечения, включающую в качестве факторов риска мутационный статус генов, с целью прогнозирования течения заболевания у пациентов с первичными и вторичными МДС. Эти данные представлены в постере „Новая прогностическая модель у больных МДС, ранее получавших лечение“ (A Novel Prognostic Model in Heavily Treated Patients with Myelodysplastic Syndromes (MDS)) [A. Nazha et al. Abstract 168].
У 333 пациентов проанализированы клинические данные и мутационный статус генов. Медиана возраста составила 68 лет, у 37 (11%) пациентов был вторичный МДС, у 43 (13%) — ХММЛ. Во всей проанализированной группе число линий предшествующей терапии составило от 0 до 7. Лечение не получало 15% пациентов. Трансплантация гемопоэтических стволовых клеток (ТГСК) была выполнена у 14% пациентов. Кроме того, больным осуществлялась терапия гипометилирую-щими агентами, леналидомидом, иммуносупрессивными препаратами, а также по цитарабин-антрациклиновым программам. Полногеномное секвенирование и NGS выявили мутации 62 генов.
Посредством статистического анализа к независимым прогностическим факторам были отнесены возраст, показатель IPSS-R, мутации генов ASXL1, BCOR, BCORL1, EZH2, IDH2, SF3B1, TP53. В новой прогностической системе каждому фактору присвоен соответствующий коэффициент, и расчет проводится по формуле:
ASXL1 х 0,65 + BCOR х 0,92 + BCORL1 х (-1,65) + EZH2 х 0,71 + IDH2 х (-1,0) + SF3B1 х (-0,59) + TP53×1,24 + возраст х 0,04 + число баллов по IPSS-R х 0,43.
В зависимости от суммы баллов формируют четыре прогностические группы. Результаты, полученные исследователями, указаны в табл. 1.
Кривые общей выживаемости по прогностической системе IPSS-R и новой прогностической модели представлены на рис. 3 и 4.
Таблица 1. Группы риска по новой шкале и их прогностическое значение
Число Число Медиана общей Группа риска баллов больных выживаемости, мес. *
Низкого 0−3,4 80 47,3
прогноз
На конгрессе представлены работы, целью которых было оценить факторы риска при естественном течении МДС, а
www. medprint. ru
Промежуточного-1 3,5−4 69 30,2
Промежуточного-2 4,1−5,4 131 19,9
Высокого & gt- 5,5 53 12,2
* p & lt- 0,001.
221
0 12 24 36 48 60 72 84 96 108 120 132 144 156 168 180 192 Время, мес.
Рис. 3. Общая выживаемость больных в группах МДС, выделяемых по прогностической системе IPSS-R (n = 297)
Fig. 3. Overall survival rate in MDS patients determined on the basis of the IPSS-R prognostic system (n = 297)
0 12 24 36 48 60 72 84 96 108 120 132 144 156 168 180 192 Время, мес.
Рис. 4. Общая выживаемость больных в группах МДС, выделяемых по новой прогностической модели (n = 333- p & lt- 0,001)
Fig. 4. Overall survival rate in MDS patients determined on the basis of a new prognostic model (n = 333- p & lt- 0,001)
Таким образом, группой исследователей из Cleveland Clinic (США) предложена новая прогностическая модель, более достоверно определяющая ожидаемую общую выживаемость больных МДС вне зависимости от предшествующего лечения.
Согласно классификации ВОЗ, в настоящий момент ХММЛ рассматривается как заболевание, которое относится к группе МДС/МПО. Ранее, согласно ФАБ-классификации, ХММЛ являлся одним из вариантов МДС. В некоторых исследованиях миелодиспластиче-ский подвариант ХММЛ (с числом лейкоцитов менее 13 X 109/л или менее 12 X 109/л, по данным разных авторов) объединяют с МДС. С этой точки зрения представляют интерес прогностические балльные системы, разработанные только для больных ХММЛ. Об одной из них сообщалось в работе „Альтернативная прогностическая система для ХММЛ у когорты больных из UT MD Anderson Cancer Center“ (Validation of Alternative Chronic Myelomonocytic Leukemia (CMML)-Specific Prognostic Scoring (CPSS) System in UT MD Anderson Cancer Center Cohort) [P. Priyanka et al. Abstract 3278].
Международные прогностические системы IPSS и IPSS-R были разработаны для больных с впервые установленным диагнозом, которые ранее не полу-
чали лечения. В эти системы не включали больных ХММЛ. (Примечание от автора обзора конгресса: в систему IPSS все же были включены пациенты с диспластическим ХММЛ с числом лейкоцитов менее 12 X 109/л — 126 [15%] больных, в то время как из базы данных International MDS Risk Analysis Workshop [IMRAW] - только больные МДС). В связи с этим была представлена прогностическая система для ХММЛ у когорты больных из UT MD Anderson Cancer Center, альтернативная прогностической системе (CPSS), созданной в 2013 г. для этой же группы больных.
В исследование включено 203 пациента (132 мужчины, 71 женщина) с впервые выявленным ХММЛ, не получавших лечения. Медиана возраста составила 70 лет. У 149 больных установлен диагноз ХММЛ-1 и у 54 — ХММЛ-2. Факторы, учитываемые в прогностической системе, указаны в табл. 2, а окончательное распределение больных по группам риска — в табл. 3.
Кривые общей выживаемости в зависимости от времени установления диагноза представлены на рис. 5.
Альтернативная прогностическая система открывает дополнительные возможности для стратификации больных по группам риска.
Известно, что сложный кариотип у больных МДС предполагает наличие 3 и более цитогенетических ано-
Таблица 2. Шкала оценки прогностических признаков по альтернативной прогностической системе для ХММЛ
Оценка, баллы
Признак 0 1 2
Вариант по ВОЗ-классификации ХММЛ-1 (число бластных клеток, включая промоноциты, & lt- 5% в крови и & lt- 10% в костном мозге) ХММЛ-2 (число бластных клеток, включая промоноциты, — 5−19% в крови и 10−19% в костном мозге или наличие палочек Ауэра вне зависимости от числа бластных клеток)
Вариант по ФАБ-классификации ХММЛ-МД ХММЛ-МП —
Цитогенетические группы риска ХММЛ Низкий Промежуточный Высокий
Уровень гемоглобина & gt- 100 г/л & lt- 100 г/л —
ХММЛ-МД — миелодиспластический тип ХММЛ (число лейкоцитов & lt- 13×109/л), ХММЛ-МП — миелопролиферативный тип ХММЛ (число лейкоцитов & gt- 13×109/л).
Цитогенетические группы риска ХММЛ: низкий — нормальный кариотип или изолированная промежуточный — другие аномалии- высокий — трисомия хромосомы 8, сложный кариотип (& gt- 3 аномалий), аномалии хромосомы 7.
222
Клиническая онкогематология
Таблица 3. Прогностическое значение групп риска по альтернативной прогностической системе для ХММЛ
Группа риска Сумма баллов Медиана общей выживаемости, годы
Низкий 0 4,07
Промежуточный-1 1 3,32
Промежуточный -2 2−3 2,14
Высокий 4−5 1,23
Время после установления диагноза, годы
Рис. 5. Общая выживаемость больных в различных группах риска по альтернативной прогностической системе для ХММЛ (n = 203)
Fig. 5. Overall survival rate of patients in different risk groups on the basis of an alternative prognostic system for chronic myelomono-cytic leukemia (n = 203)
Ф
малий. Он рассматривается в качестве неблагоприятного фактора практически во всех прогностических системах. Помимо сложного кариотипа независимое отрицательное значение в отношении прогноза имеет мутация гена TP53. Сочетание мутации TP53 со сложным кариотипом имеет крайне неблагоприятный прогноз, однако объективных данных в пользу этого утверждения недостаточно. С этой целью проведено исследование, результаты которого опубликованы в постере „Формирование двух групп прогноза больных МДС со сложным кариотипом на основании мутационного статуса гена TP53: анализ объединенной базы данных международной рабочей группы“ (TP53 Mutation Status Divides MDS Patients with Complex Karyotypes into Distinct Prognostic Risk Groups: Analysis of Combined Datasets from the International Working Group for MDS-Molecular Prognosis Committee) [R. Bejar et al. Abstract 532].
Проанализировано 258 сложных кариотипов у больных МДС. Мутационный статус гена TP53 определен у 223 пациентов. В 133 (60%) наблюдениях выявлена мутация TP53. Больные с этой мутацией были старше, чем пациенты в группе без нее (медиана возраста составила 70,8 и 65,5 года соответственно- p = 0,055). Они характеризовались более выраженной тромбоци-топенией (медиана числа тромбоцитов 42 vs 78×109/л- p = 0,002), а также большим числом бластных клеток в костном мозге (7,75 vs 4%- p = 0,03). Пациенты с мутацией TP53 чаще имели моносомный кариотип с 5 хромосомными аномалиями и более, а также аномалии хромосомы 17. Все перечисленные цитогенетические особенности были статистически значимыми.
www. medprint. ru
При наличии мутации TP53 медиана общей выживаемости была значительно меньше (7,7 vs 23,4 мес.- p & lt- 0,0001), что отражено на рис. 6. Многофакторный анализ выявил ряд других важных прогностических признаков общей выживаемости: моносомный кариотип, число хромосомных аномалий, число бластных клеток и тромбоцитов. Кроме того, в работе было показано, что мутация гена TP53 имеет более существенное отрицательное значение, чем моносомный кариотип при МДС со сложным кариотипом.
Множество мутаций TP53 свидетельствует о наличии субклонов заболевания. В подобных случаях даже незначительное количество клеток с мутациями может указывать на неблагоприятный прогноз. Таким образом, соматические мутации TP53 у больных МДС со сложным кариотипом позволяют выделить группы с различной общей выживаемостью.
Имеются сведения о том, что прогноз у больных МДС после неудачи лечения гипометилирующими препаратами неблагоприятный. В этой связи было инициировано исследование „Факторы прогноза ответа на лечение и выживаемость у пациентов с МДС после неудачи лечения гипометилирующими препаратами: первичная и вторичная резистентность“ (Predictive Factors for Response and Survival in Patients with Myelodysplasie Syndromes (MDS) after Hypomethylating Agent (HMA) Failure: Primary Resistance (PriRes) Vs. Secondary Resistance (SecRes)) [K. Sasaki et al. Abstract 1922].
В исследование включено 149 больных МДС, которые после неудачи лечения гипометилирующими агентами (ГА) получали вторую линию терапии. Деци-табин и азацитидин назначались равному числу больных. В дальнейшем 23 пациентам была выполнена аллоТГСК. Трансформация в ОМЛ после неудачи терапии ГА отмечена у 15 пациентов. Таким образом, в работе оценены данные 93 больных с первичной и вторичной резистентностью МДС. Понятие „первичная резистентность“ подразумевает отсутствие какого-либо ответа на терапию ГА. Вторичная резистентность обозначает утрату достигнутого эффекта при лечении ГА. В исследовании было сформировано четыре группы второй линии терапии:
1) со сменой ГА (азацитидин на децитабин и наоборот),
2) получавших цитарабин, 3) клофарабин или 4) новые исследуемые препараты.
Время, мес.
Рис. 6. Общая выживаемость больных МДС со сложным кариотипом и наличием/отсутствием мутации гена TP53 (n = 223)
Fig. 6. Overall survival rate of MDS patients with complex karyotype and presence/absence of TP53 gene mutation (n = 223)
223
Из 93 больных у 30 (32%) была констатирована первичная резистентность и у 63 (68%) — вторичная. В качестве первой линии терапии 34 (37%) получали азаци-тидин и 59 (63%) децитабин. В общей группе медиана наблюдения составила 16 мес., медиана возраста — 65 лет (диапазон 20−85 лет), медиана продолжительности лечения азацитидином и децитабином — 5,6 и 7,2 мес.
Первичная резистентность отмечена у 14 (41%) и 16 (27%) пациентов, получавших азацитидин и децитабин соответственно. Медиана продолжительности терапии ГА составила при первичной и вторичной резистентности 1,1 и 10,5 мес. соответственно (р & lt- 0,001). Из 63 больных со вторичной резистентностью у 11 (18%) получена полная ремиссия. Из 30 больных с первичной резистентностью полная ремиссия достигнута у 1 (3%). Частота общего ответа при использовании всех видов терапии второй линии в обеих группах существенно не различалась. Единственным благоприятным прогностическим фактором, влияющим на ответ, была смена ГА (р = 0,019). У 2 пациентов с первичной резистентностью смена ГА (1 больной — азацитидин на децитабин и 1 — децитабин на азацитидин) позволила получить гематологическое улучшение. Среди больных со вторичной резистентностью ответ на лечение получен у 9 со сменой ГА (4 пациента — азацитидин на децитабин и 5 — децитабин на азацитидин). В группе с заменой децитабина на азацитидин у 1 больного достигнута полная ремиссия, у 2 — стабилизация заболевания, в 1 наблюдении констатирован летальный исход. В группе замены азацитидина на децитабин у 4 пациентов получена полная ремиссия, 1 — выбыл из-под наблюдения. Медиана выживаемости без прогрессирования в группах первично-резистентных и вторично-резистентных заболеваний была 5,8 и 1,8 мес. (р = 0,178). Медиана общей выживаемости в этих группах была сопоставимой (10,4 и 9,8 мес.). Неблагоприятными факторами в отношении ответа на лечение и общей выживаемости после второй линии терапии были сложный кариотип (р = 0,046) и лечение клофарабином (р = 0,025).
Таким образом, прогноз у больных в случае неудачи лечения ГА неблагоприятный. Необходимо проведение дальнейших исследований в данном направлении.
лечение
Следует отметить, что доклады о значительных достижениях в терапии МДС на конгрессе ASH-2014 практически отсутствовали. Многие постерные сообщения освещали результаты применения ГА и леналидомида у разных категорий больных, а также различные дозовые режимы и их комбинированное использование с препаратами из других групп. В ряде работ опубликованы новые направления лечения МДС.
Терапия Г А является стандартом лечения больных МДС и ХММЛ. Частота полных ремиссий колеблется в пределах 7−35% с медианой продолжительности 9−10 мес. и медианой общей выживаемости 20−24 мес. АллоТГСК позволяет добиться выздоровления у ряда больных. Однако остается открытым вопрос об отдаленных результатах лечения ГА, которому было посвящено постерное сообщение „Отдаленные результаты лечения больных МДС гипометилирующими агентами: сообщение консорциума проведения клинических исследований при МДС“ (Long-Term Outcome of Patients
224
with Myelodysplasie Syndromes (MDS) Treated with Hypomethylating Agents (HMA): A Report on Behalf of the MDS Clinical Research Consortium) [E. Jabbour et al. Abstract 4641].
В это исследование включено 511 пациентов с МДС (n = 409) и ХММЛ (n = 102), получавших лечение ГА. Больные, которым была выполнена аллоТГСК (n = 65), исключены из исследования, т. е. были проанализированы данные 446 пациентов. Медиана наблюдения составила 13,6 мес., медиана возраста — 70 лет. Предшествующие злокачественные опухоли были у 198 (44%) больных, 133 (30%) участника получали предшествующую химиотерапию, а лучевую — 85 (19%). Варианты МДС были следующими: рефрактерная анемия (n = 47, 10,5%), рефрактерная анемия с кольцевыми сидеробластами (n = 16, 4%), рефрактерная цитопения с мультилинейной дисплазией (n = 75, 17%), рефрактерная анемия с избытком бластов (n = 204, 46%), МДС неклассифицируемый (n = 8, 2%), ХММЛ (n = 95, 21%).
Лечение азацитидином проводилось 189 (42%) пациентам, децитабином — 257 (58%). Полные ремиссии получены у 124 (28%) больных, полные ремиссии с неполным восстановлением числа тромбоцитов — у 27 (6%), частичные ремиссии — у 9 (2%), гематологическое улучшение — у 31 (7%), отсутствие ответа констатировано у 121 (27%) пациента, летальный исход в период терапии — у 23 (5%), не оценены — 6 (1,4%) пациентов, выбыли из-под наблюдения — 105 (23,5%). Медиана продолжительности ответа составила 7,2 мес. (диапазон 1−68 мес.), трансформация в ОМЛ зарегистрирована у 130 (29%) больных. Ко времени публикации сообщения под наблюдением оставалось 133 (30%) пациента. Медиана выживаемости без трансформации в лейкоз и медиана общей выживаемости были 16,1 и 16,2 мес. соответственно. Показатели 2- и 5-летней выживаемости без трансформации в лейкоз составили 29 и 11%, общей 2- и 5-летней выживаемости — 34 и 12% соответственно.
По данным многофакторного анализа, лабораторные показатели, влияющие на общую выживаемость, включали число лейкоцитов (& gt- 4 vs & lt-4 X 109/л), уровень ферритина (& gt- 500 vs & lt- 500 мкг/л), уровень гемоглобина (& gt- 100 vs & lt- 100 г/л), число тромбоцитов (& gt- 500 vs & lt- 500 X 109/л) и особенности кариотипа (группа высокого vs промежуточного vs низкого риска). При наличии 0−2 (n = 265) и 3−5 факторов (n = 180) медиана общей выживаемости была 18 и 14 мес. соответственно (p = 0,001).
Таким образом, в исследовании были показаны непосредственные и отдаленные результаты применения ГА, а также факторы, влияющие на прогноз у больных МДС и ХММЛ.
Несмотря на то что азацитидин (AZA) является перспективным противоопухолевым лекарственным средством, улучшающим прогноз у больных МДС из группы высокого риска, монотерапию этим препаратом можно считать неадекватной при прогрессировании МДС (трансформация в ОМЛ) и агрессивном течении заболевания (аМДС), которое сопровождается клиническими проявлениями: лихорадкой, отеками и т. д. В таких ситуациях сообщалось об использовании малых доз цитара-бина (AraC) перед терапией азацитидином (AraC^AZA). M. Hirai и соавт. представили постер о сравнении
Клиническая онкогематология
монотерапии (sAZA) с комбинированной терапией AZA и малыми дозами AraC (LDAraC) „Удовлетворительная переносимость и высокая эффективность комбинации азацитидина с малыми дозами цитарабина у больных МДС и ОМЛ“ (Azacitidine (AZA) Combination Therapy with Low-Dose AraC Is Well Tolerated and Highly Effective for MDS with Overt Leukemia) [M. Hirai et al. Abstract 3260].
Схема лечения (LDAraC^AZA) более успешно применялась у пожилых пациентов, а также у больных аMДС и ОMЛ по сравнению с монорежимом sAZA. В дальнейшем стал использоваться 7-дневный комбинированный режим терапии LDAraC + AZA: азацитидин 75 мг/м2, цитарабин 20 мг/м2 п/к через 5−8 ч. Полные ремиссии получены у 6 из 10 больных ОMЛ после 1-го курса LDAraC + AZA. Лечение характеризовалось удобством и высокой эффективностью этого режима введения препаратов у пожилых пациентов.
В представленное пилотное исследование включено 50 больных. Из них у 29 был MAQ у 4 — ХMMЛ и у 17 — ОMЛ (в 3 наблюдениях — рецидив ОMЛ). У всех больных M^ и ХMMЛ отмечались прогрессирование или клинические проявления заболевания.
Сформировано две группы пациентов, получавших лечение sAZA (n = 22) и LDAraC + AZA или LDAraC^AZA (n = 27). Частота ответа на лечение в первой группе составила 27%, а во второй — 74%. Mедиана общей выживаемости в первой группе была значимо меньше (5,8 vs 19 мес.- p = 0,002) при сопоставимой частоте побочных эффектов. Через 2,5 года наблюдения наилучшие результаты были получены у больных, в т. ч. с ОMЛ, у которых применялась программа LDAraC + AZA. Данная работа показала синергизм между ГА и AraC.
В ряде постерных сообщений были изложены результаты исследования леналидомида, который обычно назначается больным MДС с синдромом 5q- при симптоматической анемии, но без выраженной лейко- и тромбоцитопении. К настоящему времени проведены клинические исследования препарата у пациентов без del (5q), однако результаты лечения в этой группе больных хуже. Таким образом, подходы к лечению транс-фузионно-зависимых пациентов с MДС низкого риска без делеции 5q, которые не отвечают или резистентны к терапии эритропоэзстимулирующим препаратам, ограничены. Во II фазе исследования MDS-002 (CC-5013-MDS-002) применение леналидомида позволило достичь периода прекращения трансфузий эритроцитов длительностью 56 дней и более у 26% больных с низким/промежуточным-1 риском по шкале IPSS без del (5q). Использование леналидомида в подобных ситуациях было продолжено в III фазе исследования (CC-5013-MDS-005), результаты которого доложены в постере „Эффективность и безопасность леналидомида по сравнению с плацебо у трансфузионно-зависимых пациентов с МДС низкого/промежуточного-1 риска по IPSS без делеции 5q, не ответивших на терапию эритропоэзстимулирующими препаратами: результаты III фазы рандомизированного исследования“ (Efficacy and Safety of Lenalidomide (LEN) Versus Placebo (pBO) in RBC-Transfusion Dependent (TD) Patients (Pts) with IPSS Low/Intermediate (Int-1)-Risk Myelodysplastic Syndromes (MDS) without Del (5q) and Unresponsive or Refractory to Erythropoiesis-Stimulating Agents
www medprint. ru
(ESAs): Results from a Randomized Phase 3 Study (CC-5013-MDS-005)) [V. Santini et al. Abstract 409].
В многоцентровое рандомизированное двойное слепое исследование III фазы были включены трансфузи-онно-зависимые пациенты с МДС, получавшие не менее 2 трансфузий эритроцитной массы каждые 28 дней в течение 112 дней непосредственно перед рандомизацией, с низким/промежуточным-1 риском по IPSS, без делеции 5q и резистентные к терапии эритропоэзстимулирующими препаратами (ЭСП).
Пациенты были рандомизированы в соотношении 2:1 на принимавших леналидомид 10 мг внутрь 1 раз в сутки (5 мг для пациентов с клиренсом креатинина 40−60 мл/мин) и принимавших плацебо. Всего в исследование включено 239 пациентов (леналидомид, n = 160- плацебо, n = 79). Медиана возраста составила 71 год (диапазон 43−87 лет), медиана времени от установления диагноза — 2,6 года (диапазон 0,1−29,6 года). У большинства (90%) пациентов наблюдался ответ (не нуждались в трансфузиях эритроцитов 56 дней и более) в течение 16 нед. лечения. Медиана продолжительности отсутствия необходимости в трансфузиях эритроцитов составила 8,2 мес.
Статистически значимыми факторами, положительно влияющими на отсутствие необходимости в трансфузиях эритроцитов, были предшествующая терапия ЭСП (по сравнению с ее отсутствием- p = 0,005), эндогенный эритропоэтин не более 500 ЕД/л (по сравнению с его уровнем более 500 ЕД/л- p = 0,015), менее 4 трансфузий эритроцитов за 28 дней (vs & gt- 4 трансфузий за 28 дней- p = 0,036), женский пол (p = 0,035).
Отсутствие необходимости в переливаниях эритроцитов в течение 168 дней и более было достигнуто у 17,5 и 0% больных в группах, получавших леналидомид и плацебо соответственно. Частота летальных исходов составила 2,5% в обеих группах. Период наблюдения был недостаточным для расчета общей выживаемости в группах сравнения. Миелосупрессия оказалась основным побочным эффектом в группе леналидомида vs плацебо: нейтропения III-IV степени (61,9 vs 11,4%), тромбо-цитопения III-IV степени (35,6 vs 3,8%). Прекращение терапии из-за нежелательных явлений зарегистрировано в 31,9% наблюдений в группе получавших леналидомид. Ее причинами были тромбоцитопения (n = 14) и нейтро-пения (n = 8).
Терапия леналидомидом позволила значительно снизить число больных, нуждающихся в трансфузиях эритроцитов (26,9%), со средней продолжительностью 8,2 мес. Всего на лечение ответило 90% больных в течение первых 16 нед. Общий профиль токсичности леналидомида подтверждает возможность использования препарата у этой категории пациентов.
Как указывалось выше, применение леналидомида (LEN) в монорежиме при МДС с del (5q) продемонстрировало удовлетворительные результаты. У пациентов без del (5q) частота ответа на это лечение существенно меньше (примерно 26%), а длительность достигнутого эффекта короче. По этой причине инициировано исследование комбинации LEN c вальпроевой кислотой. Валь-проевая кислота (VPA) — противосудорожное средство, обладающее свойствами ингибитора гистондеацетилазы, которое способно уменьшить выраженность цитопении при МДС низкого риска. Данная работа опубликована
225
в постерном сообщении „Результаты лечения больных МДС с благоприятным прогнозом комбинацией валь-проевой кислоты и леналидомида: II фаза клинического исследования Valena“ (A Phase II Study of Valproic Acid and Lenalidomide Combination Therapy in Patients with Myelodysplasie Syndrome (MDS) and a Favorable Risk Profile: Final Results of the Valena Trial) [A. Kuendgen et al. Abstract 1918].
В исследование включено 23 пациента. Медиана возраста составила 66 лет (диапазон 48−81 год). У 16 больных была рефрактерная цитопения с мульти-линейной дисплазией (РЦМД), у 3 — рефрактерная цитопения с мультилинейной дисплазией и кольцевыми сидеробластами (РЦМД-КС), у 1 — рефрактерная анемия (РА), у 3 — рефрактерная анемия с избытком бластных клеток-1 (РАИБ-1). Распределение по шкале IPSS: низкий риск (n = 11) и промежуточный-1 (n = 12). VPA назначалась в дозе с целевой концентрацией препарата в сыворотке 50−110 мкг/л. LEN применялся по 10 мг в сутки на протяжении 21 дня (длительность курса 28 дней). Запланированное 16-недельное лечение завершило только 12 больных в связи с гематологической токсичностью. У большинства (n = 19) пациентов был нормальный кариотип. Молекулярное исследование (обнаружение мутаций генов DNMT3A, EZH2, CBL, RUNX1, TET2, JAK2, FLT3, MLL-PTD, KRAS, NRAS, ASXL1, IDH1, ?DH2, TP53, SF3B1, SRSF2) выполнено у 10 из 23 пациентов.
Результаты лечения оценены в соответствии с критериями Международной рабочей группы (IWG) 2006 г. у 9 из 23 больных. Полная ремиссия с сохраняющейся дисплазией получена в 3 наблюдениях, костномозговая полная ремиссия с гематологическим улучшением эритропоэза — в 1, стабилизация МДС с гематологическим улучшением эритропоэза — в 5. У 13 пациентов констатирована стабилизация заболевания, у 1 — про-грессирование. Гематологическое улучшение позволило прекратить гемотрансфузии. Медиана продолжительности ответа составила 8 мес. (диапазон 6−20 мес.).
Корреляции между ответом на терапию и вариантами МДС, числом бластных клеток, цитогенетическими аномалиями, группами риска по шкалам IPSS и IPSS-R не выявлено. Кроме того, не обнаружено связи и с молекулярным профилем генов.
Таким образом, клиническое исследование продемонстрировало возможность получения эффекта у 39% (9 из 23) больных МДС. Однако выраженность гематологической токсичности оказалась выше предполагаемой, что послужило причиной редукции первоначальной дозы леналидомида.
По данным M.A. Cherian и соавт., азацитидин и децитабин показаны в качестве терапии первой линии у больных МДС промежуточного и высокого риска. При использовании ГА в первой линии терапии ответ на лечение составляет 40−47%. Медиана его продолжительности 13 мес. Выбор лечения при неудаче терапии ГА или про-грессировании МДС представляется затруднительным.
Как правило, при отсутствии ответа на ГА, уровне эндогенного эритропоэтина более 500 ЕД/л и отсутствии показаний к применению иммуносупрессивной терапии больным предлагается продолжение лечения по программам, разработанным для ОМЛ. Однако у этой категории больных M.A. Cherian и соавт. предприняли
226
попытку оценить эффективность леналидомида. Результаты исследования изложены в сообщении „Применение высоких доз леналидомида в индукции ремиссии и малых доз леналидомида в поддерживающей терапии у больных МДС, рефрактерных к гипометилирующим агентам“ (A Study of High Dose Lenalidomide Induction and Low Dose Lenalidomide Maintenance for Patients with Hypomethylating Agent Refractory MDS) [M.A. Cherian et al. Abstract 1931].
Авторы работы инициировали исследование II фазы по применению высоких доз леналидомида (50 мг в сутки в течение двух 28-дневных циклов) с последующей поддерживающей терапией малыми дозами леналидомида (10 мг в сутки, суммарно 12 циклов) у больных МДС по ФАБ-классификации с рефрактерностью к ГА. В исследование включено 24 пациента, 16 из которых завершили не менее 1 курса терапии. Полные или частичные ремиссии не получены. У 8 (50%) из 16 больных достигнута костномозговая полная ремиссия. У 1 из 8 больных была делеция 5q, у 3 — трисомия хромосомы 8, у 1 — сложный кариотип с моносомией хромосомы 7. Гематологическое улучшение отмечено у 2 (12,5%) из 16 пациентов. Нежелательными явлениями III степени и выше были пневмонии (50%), сепсис (17%), фебрильная нейтропения (33%), сыпь (8%), тромбоэмболия и вторая опухоль (по 1 осложнению в общей группе). В качестве следующего этапа изучения высоких доз леналидомида при МДС исследователи планируют применение чередующегося дозового режима.
Данные о прогностических факторах при использовании иммуносупрессивной терапии (ИСТ) у больных МДС достаточно противоречивы. В качестве кандидатов на ИСТ одними исследователями рассматриваются пациенты с МДС низкого или промежуточного-1 риска по шкале IPSS, моложе 60 лет, с нормальным кариотипом или трисомией хромосомы 8 [S.B. Killick et al. Guidelines for the diagnosis and management of adult myelodysplastic syndromes. Br. J. Haematol. 2014- 164: 503−25]. Согласно рекомендациям Национальной всеобщей онкологической сети США (National Comprehensive Cancer Network [NCCN]) 2014 г., ИСТ целесообразно проводить больным из группы низкого или промежуточного-1 риска по шкале IPSS, в возрасте до 60 лет, с числом бластных клеток в костном мозге не более 5%, при гипоплазии кроветворения, при HLA-DR15+, наличии клона клеток, составляющих субстрат пароксизмальной ночной гемо-глобинурии.
Кроме того, отдаленные результаты лечения имму-носупрессивными препаратами больных МДС низкого и промежуточного-1 риска в литературе изложены недостаточно, а вопрос о назначении этого вида терапии в случае резистентности к ЭСП остается открытым.
Группа исследователей из Франции опубликовала постер „Отдаленные результаты лечения больных МДС низкого риска иммуносупрессивными препаратами (антитимоцитарный глобулин ± циклоспорин А)“ (Long-Term Outcome of Lower-Risk MDS Patients after Immunosuppressive Therapy (IST) with Anti-Thymocyte Globulin (ATG) +/- Cyclosporin A (CsA)) [Ch. Kelaidi et al. Abstract 1921].
В исследование включено 15 пациентов с МДС низкого риска, которым назначался лошадиный или кроличий антитимоцитарный глобулин (АТГ) по 15 мг/кг в сутки
Клиническая онкогематология
или 3,5 мг/кг в сутки соответственно в течение 5 дней в комбинации с циклоспорином, А (ЦСА) по 2 мг/кг 2 раза в сутки в течение 6 мес. Медиана возраста составила 60 лет (диапазон 46−77 лет), медиана периода наблюдения — 8,1 года. Все больные были трансфузионно-зависимыми. Медиана продолжительности трансфузий эритроцитов составила 4,9 мес. Число тромбоцитов менее 50×109/л и менее 20×109/л было у 85 и 50% пациентов соответственно. Медиана абсолютного числа нейтрофилов составила 0,95×109/л. Варианты МДС по классификации ВОЗ: РА (п = 5), РЦМД (п = 6), РАИБ (п = 1). Вариант МДС не установлен у 2 больных в связи с гипоплазией костного мозга. Медиана числа бластных клеток составила 1% (диапазон 0−8%). Число миело-кариоцитов в костном мозге было снижено у 9 из 14 оцененных больных. Клон клеток — субстрат пароксиз-мальной ночной гемоглобинурии — идентифицирован в 4 наблюдениях. В оцениваемой группе (п = 14) частота общего ответа на терапию АТГ + ЦСА составила 50%, в 4 наблюдениях отмечена полная ремиссия. Кумулятивная 5-летняя частота неудачи лечения (прогрессирование или трансформация в ОМЛ) составила 42 и 6% соответственно при медиане общей выживаемости 5,6 года. Медиана общей выживаемости у больных, ответивших на терапию, не достигнута. Больные МДС низкого риска, ответившие на ИСТ, характеризовались благоприятным отдаленным прогнозом. У пациентов с необходимостью проведения трансфузий эритроцитов 6 мес. и менее, числом бластных клеток 2% и менее вероятность ответа на лечение была значительно выше. Следует отметить, что возраст старше 60 лет не был связан с неблагоприятным прогнозом.
новые комбинации препаратов
Наше внимание привлекли сообщения о новых комбинациях препаратов, одобренных к применению как при МДС, так и при других онкологических заболеваниях Управлением по контролю за качеством пищевых продуктов и лекарственных средств США (FDA):
• LDAraC + AZA [M. Hirai et al. Abstract 3260]-
• LEN + VPA [A. Kuendgen et al. Abstract 1918]-
• AZA + LEN [C.D. DiNardo et al. Abstract 164]-
• Clofarabine + LDAraC [E. Jabbour et al. Abstract 534]-
• AZA + vorinostat [G. Garcia-Manero et al. Abstract 3277].
Первые две комбинации рассматривались выше.
В работе „Результаты исследования I-II фазы последовательного применения азацитидина и леналидо-мида у больных ОМЛ и МДС высокого риска“ (A Final Report: Phase I/II Study of Sequential Azacitidine and Lenalidomide in Patients with Higher-Risk Myelodysplastic Syndrome (MDS) and Acute Myeloid Leukemia (AML)) [C.D. DiNardo et al. Abstract 164] AZA назначался в дозе 75 мг/м2 в сутки с 1-го по 5-й день, LEN — с 6-го дня курса в течение 5 или 10 дней. Продолжительность курса 28 дней.
В I фазе настоящего исследования LEN использовался в следующих режимах: 10 мг 5 дней (n = 5), 15 мг 5 дней (n = 3), 20 мг 5 дней (n = 3), 25 мг 5 дней (n = 3), 50 мг 5 дней (n = 4), 75 мг 5 дней (n = 3) и 75 мг 10 дней (n = 7). Во II фазе начальная доза LEN составила 50 мг
www. medprint. ru
ежедневно в течение 10 дней, однако из-за миелосу-прессии и эпизодов инфекции доза LEN была снижена до 25 мг ежедневно в течение 5 дней. В исследование было включено 88 пациентов: в I фазу — 28, во II фазу — 60. Частота общего ответа составила 35% (31 из 88): полная ремиссия (n = 15), полная ремиссия с неполным восстановлением показателей гемограммы (n = 16). Mедиана общей выживаемости 33 нед. Согласно результатам проведения I фазы, частота общего ответа составила 14%, II фазы — 45%.
В исследование II фазы комбинации клофарабина (нуклеозидный аналог 2-го поколения) с малыми дозами цитарабина было включено 56 пациентов, из которых оценены 52 при медиане наблюдения 15,3 мес. Mедиана возраста составила 71 год. Предшествующую терапию азацитидином и децитабином получали 39 и 15 больных соответственно. У пациентов определяли мутационный статус генов FLT3-ITD, RAS, NPMI, JAK2.
Индукционная терапия включала клофарабин 15 мг/м2 в/в ежедневно с 1-го по 5-й день и цитарабин по 20 мг п/к 2 раза в сутки с 1-го по 7-й день. Пациенты, ответившие на лечение, получали консолидационную терапию: клофарабин 15 мг/м2 в/в с 1-го по 3-й день и цитарабин по 20 мг п/к 2 раза в сутки с 1-го по 5-й день каждые 4 нед. Mаксимальное число курсов лечения — 12.
Частота общего ответа составила 48% (полные ремиссии — 9 [17%], полные ремиссии с неполным восстановлением числа тромбоцитов — 3 [6%], полные костномозговые ремиссии — 7 [13%], стабилизация заболевания с гематологическим улучшением — 6 [12%]). Mедиана продолжительности ответа на лечение 12 мес., медиана общей выживаемости 6,8 мес. Mедиана общей выживаемости у больных, ответивших и не ответивших на терапию, была более 12,4 и 3,4 мес. соответственно. Mатериалы данной работы подробно изложены в реферате доклада „Применение комбинации клофарабина с малыми дозами цитарабина у больных МДС высокого риска с рецидивами или рефрактерностью к гипо-метилирующим агентам“ (Clofarabine Plus Low-Dose Cytarabine for the Treatment of Patients with Higher-Risk Myelodysplastic Syndromes (MDS) Who Have Relapsed or Are Refractory to Hypomethylating Agent (HMA) Therapy) [E. Jabbour et al. Abstract 534].
Известно, что прогноз при M^^ и ОMЛ у пациентов с тяжелым общим состоянием, нарушением функции органов, а также другими сопутствующими заболеваниями неудовлетворительный. В подобных ситуациях становится невозможным проведение адекватной противоопухолевой терапии и большинство пациентов исключаются из клинических исследований.
В исследование комбинации азацитидина (А) с во-риностатом (ингибитором гистондеацетилазы- V) было включено 79 пациентов с подобными характеристиками. Его результаты опубликованы в постере „Азацитидин по сравнению с комбинацией азацитидин + вориностат у больных с впервые диагностированными ОМЛ и МДС высокого риска с неудовлетворительным общим состоянием, дисфункцией органов и другими сопутствующими заболеваниями: рандомизированное исследование II фазы“ (A Bayesian Phase II Randomized Trial of Azaciti-dine Versus Azacitidine + Vorinostat in Patients with Newly Diagnosed AML or High-Risk MDS with Poor Performance Status, Organ Dysfunction, or Other Comorbidities) [G.
227
Garcia-Manero et al. Abstract 3277]. В группе, А (n = 27) лечение осуществлялось азацитидином в дозе 75 мг/м2 в/в в течение 5 дней подряд, в группе А+V (n = 52) азацитидин вводился в том же дозовом режиме с вориностатом по 200 мг 3 раза в сутки с 1-го по 5-й день. Медиана возраста составила 70 лет (диапазон 30−90 лет), медиана числа бластных клеток в костном мозге 8% (диапазон 1−89%), медиана числа лейкоцитов 2,8 X 109/л. Наличие или указание в анамнезе на вторую злокачественную опухоль было у 36 (46%) больных, общее состояние по шкале ECOG & gt- 2 баллов — у 9 (11%). Среди сопутствующих заболеваний отмечались фиброз легких, нарушение функции почек и/ или печени, наличие ВИЧ-инфекции.
Частота общего ответа (полные ремиссии + полные ремиссии с неполным восстановлением числа тромбоцитов) составила 44% в группе, А и 35% в группе A+V (p = 0,395). Медиана общей и безрецидивной выживаемости в общей группе пациентов была 7,1 и 5,9 мес. Медиана общей выживаемости у больных из групп A и A+V составила 6,1 и 5,9 мес. (p = 0,9) — медиана безрецидивной выживаемости в этих группах — 5,9 и 8,7 мес. соответственно (p = 0,5). Данная работа демонстрирует целесообразность проведения противоопухолевого лечения больным, которых не представляется возможным включить в клинические исследования.
новые препараты
Ряд постерных сообщений посвящен исследованию нового препарата ригосертиб (rigosertib), химическая структура которого изображена на рис. 7.
Выбор следующей линии терапии после неудачи лечения ГА затруднителен. В многоцентровом рандомизированном контролируемом исследовании ONTIME III фазы изучалась безопасность и эффективность противоопухолевого препарата ригосертиб у больных МДС после неудачи лечения ГА. Ригосертиб представляет собой малую молекулу, ингибирующую сигнальные пути киназ PI3 (phosphatidylinositide-3-kinase) и PLK (polo-like kinase).
В докладе „Общая выживаемость больных МДС высокого риска при использовании ригосертиба или наилучшей сопроводительной терапии после неудачи лечения гипометилирующими агентами: исследование фазы III“ (Overall Survival and Subgroup Analysis from a Randomized Phase III Study of Intravenous Rigosertib Versus Best Supportive Care (BSC) in Patients (pts) with Higher-Risk Myelodysplastic Syndrome (HR-MDS) after Failure of Hypomethylating Agents (HMAs)) [G. Garcia-Manero et al. Abstract 163] сообщалось о включении в исследование 299 пациентов с МДС высокого риска с прогрессированием (37%), без ответа на
Рис. 7. Химическая структура ригосертиба [http: //www. diagnoz-rak. info]
Fig. 7. Chemical structure of rigosertib [http: //www. diagnoz-rak. info]
терапию (25%) и рецидивом после лечения ГА (38%). Ригосертиб и наилучшую сопроводительную терапию получило 199 и 100 больных соответственно. Ригосертиб назначался по 1800 мг в сутки в виде 72-часовой в/в инфузии каждые 2 нед. в течение первых 16 нед., а далее — каждые 4 нед.
Медиана общей выживаемости у больных, получавших ригосертиб и наилучшую сопроводительную терапию, составила 8,2 vs 5,9 мес. соответственно. Различий в профиле токсичности в обеих группах сравнения не было.
Аналогичное сообщение представлено в постере „Влияние числа бластных клеток костного мозга на общую выживаемость больных МДС высокого риска, получавших ригосертиб после неудачи лечения гипометилирующими агентами“ (Relationship of Bone Marrow Blast (BMBL) Response to Overall Survival (OS) in Patients with Higher-Risk Myelodysplastic Syndrome (HR-MDS) Treated with Rigosertib after Failure of Hypomethylating Agents (HMAs)) [L.R. Silverman et al. Abstract 3259].
Исследование костного мозга было выполнено 156 больным из группы ригосертиба и 24 — из группы наилучшей сопроводительной терапии к 4 нед. лечения, а также 86 и 20 пациентам к 12 нед.
Поскольку различий в общей выживаемости в двух группах сравнения не было, больных разделили на две подгруппы: с костномозговым ответом + стабилизация заболевания vs прогрессирование МДС. У больных, получавших ригосертиб с ответом на лечение, медиана общей выживаемости составила 9,8 vs 4,6 мес. у больных с прогрессированием МДС (p = 0,011). После исследования костного мозга на 12-й неделе лечения в подгруппе с уменьшением или стабилизацией числа бластных клеток медиана общей выживаемости составила 10,4 мес., а при прогрессировании — 7,5 мес. Авторы делают вывод о корреляции между числом бластных клеток в костном мозге и показателями общей выживаемости.
В „Исследовании I-II фазы комбинации ригосер-тиба для приема внутрь и азацитидина у больных МДС и ОМЛ“ (A Phase I/II Study of the Combination of Oral Rigosertib and Azacitidine in Patients with Myelodysplastic Syndrome (MDS) or Acute Myeloid Leukemia (AML)) [Sh.C. Navada et al. Abstract 3252] ригосертиб назначался в разных дозах 2 раза в сутки с 1-го по 21-й день курса, а азацитидин 75 мг/м2 в сутки в течение 7 дней подряд, начиная с 8-го дня курса. В исследование было включено 18 пациентов с МДС промежуточного-1 риска (n = 3), промежуточного-2 риска (n = 6), высокого риска (n = 2), с ХММЛ (n = 1) и ОМЛ (n = 6). Медиана возраста составила 70,5 года. Распределение по цитогенетическим группам прогноза по шкале IPSS было следующим: благоприятный (n = 8), неблагоприятный (n = 8) и промежуточный (n = 2). У 11 из 18 больных были показания к трансфузиям эритроцитов (n = 11) и тромбоцитов (n = 6). Более половины пациентов ранее получали лечение ГА.
Согласно критериям Международной рабочей группы (IWG), достигнуты полная ремиссия (n = 1), частичная ремиссия (n = 4), стабилизация заболевания (n = 2), гематологическое улучшение эритропоэза (n = 1). По ряду причин остальные больные не были оценены. Профиль токсичности комбинации ригосертиба и азацитидина существенно не отличался от такового при использовании азацитидина в монорежиме.
228
Клиническая онкогематология
К другому классу новых противоопухолевых препаратов относится биринапант (birinapant), который представляет собой малую молекулу — пептидомиметик (peptidomimetic), т. е. соединение, содержащее небелковые структурные элементы, которые способны копировать биологическую активность природных белковых молекул или противодействовать ей [http: //medicalcollege. ru/]. Би-ринапант является вторым митохондриальным активатором каспаз (second mitochondrial-derived activator of caspases — SMAC) и индуктором апоптоза опухолевых клеток, а также ингибитором NFkB. На основании противоопухолевого эффекта этого препарата на доклиническом этапе авторы инициировали I фазу клинического исследования, представленного в постере „Исследование I фазы монотерапии биринапантом у пациентов с рецидивами МДС и ОМЛ“ (A Phase I Study Using Single Agent Birinapant in Patients with Relapsed Myelodysplastic Syndrome and Acute Myelogenous Leukemia) [N.V Frey et al. Abstract 3758].
В работу было включено 20 больных: МДС (n = 1), ОМЛ (n = 19). Медиана возраста составила 75 лет. Препарат применялся в разных дозах: по 17, 22 и 26 мг/м2 1, 2 и 3 раза в неделю.
Ко времени настоящей публикации оптимальным эффектом были стабилизация заболевания и снижение числа бластных клеток в костном мозге с 60 до 10%. Максимальная активность препарата наблюдалась в до-зовом режиме 17 мг/м2 2 раза в неделю в течение 3 нед. Эти впервые опубликованные данные свидетельствуют о хорошей переносимости препарата и возможности его комбинированного применения.
Представляет интерес доклад о клиническом использовании нового ГА SGI-110 „Первые результаты клинического рандомизированного исследования II фазы SGI-110, нового гипометилирующего агента для подкожного введения, у 102 больных МДС промежуточного или высокого риска и ХММЛ“ (First Clinical Results of a Randomized Phase 2 Dose-Response Study of SGI-110, a Novel Subcutaneous (SC) Hypomethylating Agent (HMA), in 102 Patients with Intermediate (Int) or High Risk (HR) Myelodysplastic Syndromes (MDS) or Chronic Myelomonocytic Leukemia (CMML) [G. Garcia-Manero et al. Abstract 529].
SGI-110 относится к ГА 2-го поколения и представляет собой динуклеотид, разработанный как производное децитабина и дезоксигуанозина. Это лекарственное средство предназначено для п/к введения и характеризуется большим периодом полувыведения. В I фазе исследования SGI-110 установлена биологическая эффективная доза, равная 60 мг/м2 1 раз в сутки в течение 5 дней подряд, а также максимальная переносимая доза 90 мг/м2 1 раз в сутки в течение 5 дней подряд каждые 28 дней.
В исследование было включено 102 больных. Из них 53 были рандомизированы для лечения SGI-110 в дозе 60 мг/м2 и 49 — в дозе 90 мг/м2. Медиана периода наблюдения составила 8,2 мес., медиана количества курсов лечения — 5 (для впервые выявленных больных). Частота полных ремиссий и полных костномозговых ремиссий составила 19 и 22% для пациентов из групп 60 и 90 мг/м2, а частота исчезновения необходимости в гемотрансфузиях эритроцитов и тромбоцитов — 32 и 28% соответственно. Частота нежелательных явлений составила 81 и 88%. Расчет показателей выживаемости еще не проводился.
www. medprint. ru
Обращают на себя внимание исследования новых стимуляторов эритропоэза — ACE-536 и ACE-011, которые были доложены на секции „MДС: клинические исследования“. Первое из них „Повышение уровня гемоглобина и уменьшение необходимости в гемотранс-фузиях эритроцитов при использовании ACE-536 у больныхAC низкого и промежуточного-1 риска: предварительные результаты исследования II фазы“ (ACE-536 Increases Hemoglobin and Reduces Transfusion Burden in Patients with Low or Intermediate-1 Risk Myelo-dysplastic Syndromes (MDS): Preliminary Results from a Phase 2 Study) [U. Platzbecker et al. Abstract 411].
ACE-536 представляет собой рекомбинантный слитный белок рецептора активина типа IIB и Fc-фрагмента иммуноглобулина G. Поскольку у пациентов с MДС зачастую уровень эндогенного эритропоэтина повышен, эта категория больных оказывается рефрактерной к ЭСП. Было обнаружено, что при MДС увеличен уровень эндогенного фактора роста и дифференцировки 11 (GDF11) и Smad 2/3 (SMAD представляют собой внутриклеточные белки, ответственные за передачу внеклеточных сигналов от трансформирующего фактора роста-в [TGF-в]) в костном мозге. ACE-536 образует связь с лигандом суперсемейства TGF-в, включая GDF11, и подавляет сигнальный путь Smad 2/3, а также активирует поздние стадии дифференцировки эритроидных клеток за счет механизма, отличающегося от ЭСП.
Из всех больных, включенных в исследование, 54% получали лечение эритропоэтином, 15% - ленали-домидом. Mедиана возраста составила 71 год. У 69% участников была РЦMД, у остальных — синдром 5q-, РАКС или РАИБ-1. Представляет интерес, что у многих больных уровень эндогенного эритропоэтина превышал 500 ЕД/л.
У 2 из 7 больных с умеренной трансфузионной зависимостью уровень гемоглобина увеличился более чем на 15 г/л в течение 8 нед. Перестали нуждаться в гемотранс-фузиях 6 пациентов из этой группы. У 6 из 19 больных с высокой трансфузионной зависимостью она уменьшилась на 50% и более в течение 8 нед. У 5 из этих 6 больных достигнута трансфузионная независимость (диапазон 71 — 152 дня). Значимых различий в частоте тяжелых нежелательных явлений не было.
Вторая работа — „Открытое исследование II фазы сотатерсепта (ACE-011) у больных ^^C низкого или промежуточного-1 риска и непролиферативным вариантом ХММЛ с анемией, требующей трансфузионной терапии“ (An Open-Label, Phase 2, Dose-Finding Study of Sotatercept (ACE-011) in Patients with Low or Intermediate-1 (Int-1)-Risk Myelodysplastic Syndromes (MDS) or Non-Proliferative Chronic Myelomonocytic Leukemia (CMML) and Anemia Requiring Transfusion) [R.S. Komrokji et al. Abstract 3251]. (Примечание: непролиферативный вариант XMMЛ характеризуется числом лейкоцитов, не превышающим 12−13×109/л.)
Сотатерсепт (ACE-011) — новый первый белок рецептора активина типа НА, действующий на поздних стадиях эритропоэза, увеличивающий поступление в периферическую кровь зрелых эритроцитов. Применение сотатерсепта стимулировало эритропоэз и значительно увеличивало уровень гемоглобина у здоровых добровольцев, что послужило основанием к его использованию при анемии у больных M^^ низкого риска.
229
В исследование включено 54 пациента с МДС: 7, 6, 21 и 20 больных, получавших исследуемый препарат по 0,1, 0,3, 0,5 и 1 мг/кг соответственно. Медиана возраста составила 71 год, медиана времени от установления диагноза — 4 года. Более 4 доз эритроцитов в течение 8 нед. перед началом лечения получало 45 пациентов (высокая трансфузионная зависимость), менее 4 доз — 17% (невысокая трансфузионная зависимость). У 15% больных уровень эндогенного эритропоэтина был более 500 ЕД/л.
Из 53 оцененных больных у 21 (40%) отмечено гематологическое улучшение эритропоэза. Эффект и его продолжительность были дозозависимыми. Повышение числа тромбоцитов и нейтрофилов наблюдалось у больных с исходной тромбоцитопенией и нейтропенией. Терапия сотатерсептом больными МДС с низким риском переносилась удовлетворительно.
В рамках образовательной программы ASH-2014 мы приводим материалы лекции „Одобренные к применению и новые препараты для лечения МДС“ [M.A. Sekeres, A. Gerds. Established and novel agents for myelodysplastic syndromes. American Society of Hematology, Education Program. 56th ASH Annual Meeting and Exposition, San Francisco, California, December 6−9, 2014. Hematology. 2014. pр. 82−9].
МДС относятся к наиболее часто диагностируемым миелоидным опухолям с ежегодным выявлением более 15 000 новых случаев заболевания в США. Прогностические системы все больше вытесняют утвержденную классификацию и разделяют больных на группы низкого и высокого риска. Целью лечения пациентов с низким риском является уменьшение количества гемотрансфузий и улучшение качества жизни, а целью лечения больных с высоким риском — уменьшение вероятности трансформации в острый лейкоз и увеличение показателей выживаемости. У пациентов с низким риском и изолированной цитопенией осуществляется лечение ЭСП или факторами роста, такими как агонисты тромбопоэтина. Пациентам с цитогенетической аномалией del (5q) или при неудаче первоначальной терапии может назначаться леналидомид. У больных с низким риском и мультилинейной цитопенией возможно лечение иммуносупрессивными препаратами или малыми дозами ГА. Пациентам из группы высокого риска предпочтительно проводить первоначальное лечение ГА с оценкой возможности ТГСК. В настоящее время ведется разработка новых препаратов для больных с неудачей лечения ГА. В табл. 4 авторы лекции отражают новые подходы к лечению МДС.
На рис. 8 и 9 приведена лечебная тактика у больных МДС из разных прогностических групп.
Таблица 4. Новые потенциально эффективные препараты и их комбинации при миелодиспластических синдромах в различных прогностических группах [цит. по M.A. Sekeres, A. Gerds, 2014- c изменениями]
Препарат Механизм действия Эффективность
МДС низкого риска
Ромиплостим Агонист рецептора тромбопоэтина Уменьшает частоту и выраженность клинически значимых геморрагических осложнений, может увеличивать количество миелобластов у больных с их исходно повышенным уровнем
Элтромбопаг Агонист рецептора тромбопоэтина Повышает число тромбоцитов, улучшает качество жизни (предварительные данные)
Scio-469 Аденозинтрифосфат-конкурентный ингибитор p38a MAPK Гематологическое улучшение у 29% больных
ARRY-614 Ингибитор p38 МАРШе2-киназы Гематологическое улучшение у 22% больных
Эзатиостат Глутатионовый аналог пролекарства ингибитора GSTP1−1 Исчезновение необходимости в гемотрансфузиях у 29% больных
Сотатерсепт Слитный белок рецептора активина типа 2А Ре-фрагмента Продолжается II фаза исследования „ловушка“ для суперсемейства ТвР-в
Малые дозы Уменьшение содержания ДНК-метилтрансферазы, Гематологическое улучшение у 22−47% больных (результаты
децитабина гипометилирование 2 исследований)
Азацитидин для Гипометилирование/деплеция ДНК-метилтрансферазы Во II фазе исследования у 35% больных, ранее получавших лечение, и у
приема внутрь 60% впервые выявленных больных отмечен эффект
МДС высокого риска
Азацитидин + Уменьшение содержания ДНК-метилтрансферазы, Во II фазе исследования частота общего ответа составила 72%, полные
леналидомид гипометилирование + ингибирование цитокинов/влияние ремиссии — 44%
на микроокружение
Азацитидин + Уменьшение содержания ДНК-метилтрансферазы, Во II фазе исследования частота общего ответа составила 70%,
вориностат гипометилирование + ингибирование гистондеацетилазы полные ремиссии/полные ремиссии с неполным восстановлением
гемограммы — 42%
Азацитидин + Уменьшение содержания ДНК-метилтрансферазы, В I фазе исследования частота общего ответа составила 89%,
прациностат гипометилирование + ингибирование гистондеацетилазы полные ремиссии/полные ремиссии с неполным восстановлением
гемограммы — 78%
Азацитидин + Уменьшение содержания ДНК-метилтрансферазы, Частота 3-росткового ответа и медиана общей выживаемости сопоставимы
этиностат гипометилирование + ингибирование гистондеацетилазы с монотерапией азацитидином (24 1“ 31%- 17,7 vs 12,8 мес.)
Азацитидин + Уменьшение содержания ДНК-метилтрансферазы, воласертиб гипометилирование + ингибирование киназы PLK
Продолжается I фаза исследования
Ригосертиб Ингибирование сигнальных путей киназ Р!3 и Р1_К Сапацитабин Нуклеозидный аналог
Децитабин + Уменьшение содержания ДНК-метилтрансферазы, возароксин гипометилирование + противоопухолевый дериват хинолона, встраивающийся в ДНК и ингибирующий топоизомеразу II
Медиана общей выживаемости 8,2 V» 5,8 мес. в контрольной группе
(наилучшая сопроводительная терапия и/или цитарабин) Частота общего ответа 14%, медиана общей выживаемости 8,6 мес. У 16 оцененных больных частота общего ответа составила 81%
230
Клиническая онкогематология
Рис. 8. Алгоритм лечения больных МДС с благоприятным прогнозом
* Агонисты тромбопоэтина следует назначать вне клинических исследований только при иммунной составляющей тром-боцитопении.
Fig. 8. Algorithm of treatment of MDS patients with favorable prognosis
* Thrombopoietin agonists should be prescribed outside clinical trials only in case of immune-mediated thrombocytopenia.
Нет необходимости в гемотрансфузиях хорошее качество жизни
Лечение эритропоэз-стимулиру-ющими препаратами или гемотрансфузии эритроцитов
Неудача лечения или утрата эффекта, или наличие del (5q)
Лечение леналидомидом или участие в клинических исследованиях
Лечение агонистами тромбопоэтина*
или трансфузии тромбоцитов, или участие в клинических исследованиях
Неудача лечения или утрата эффекта
Лечение гипометилирующими агентами или участие в клинических исследованиях
Пациенты с МДС из группы неблагоприятного прогноза
с суммарным числом баллов по шкале 1РБ8 & gt- 1,5 или по шкале МРББ & gt- 4,5
Отсутствие согласия на ТГСК и/или отсутствие подходящего донора, неудовлетворительный индекс коморбидности
Раннее начало монотерапии гипометилирующими препаратами (не менее 6 курсов) или участие в клинических исследованиях с включением гипометилирующих препаратов
Имеется согласие на ТГСК, удовлетворительный индекс коморбидности
Инициация поиска родственного или неродственного донора ГСК
Гематологическое улучшение и более
Нет ответа
Участие в клинических исследованиях новых препаратов или цитостатическая противоопухолевая терапия, или наилучшая сопроводительная терапия
Пожилой возраст, небольшое число бластных клеток, промежуточный/неблагоприятный цитогенетический прогноз
Ранее начало лечения, включающего гипомети-лирующие препараты перед выполнением ТГСК
Молодой возраст, большое число бластных клеток, благоприятный цитогенетический прогноз
Интенсивная химиотерапия, аналогичная индукционной при ОМЛ
Нет подходящего, донора
Есть подходящий донор
Нет подходящего донора
Рис. 9. Алгоритм лечения больных МДС с неблагоприятным прогнозом
Fig. 9. Algorithm of treatment of MDS patients with unfavorable prognosis
www medprint. ru
Продолжение лечения гипометилирующими препаратами до утраты эффекта/ прогрессирования
Выполнение ТГСК
Мониторинг, решение вопроса о постремиссионной терапии
231
заключение
Лечение больных МДС является риск-адаптированным, исходя из цитопении, числа бластных клеток и результатов цитогенетического анализа. Поскольку при МДС обнаружено около 9 соматических мутаций, определяющих клиническое течение заболевания, препарат, который можно назвать «волшебной пулей», еще не разработан. Тем не менее существует ряд средств, уменьшающих выраженность цитопении, которые используются при МДС низ-
кого риска с целью улучшить качество жизни пациентов. Лечение комбинацией уже утвержденных при МДС препаратов и новыми агентами применяется прежде всего при МДС высокого риска. Не вызывает сомнения, что очередным направлением в лечении будет поиск лекарственных средств при неудаче терапии ГА. В ближайшее десятилетие открытия в области молекулярной биологии приведут к более глубокому пониманию природы МДС, пересмотру классификации, прогностических факторов и созданию новых подходов к лечению.
232
Клиническая онкогематология

ПоказатьСвернуть
Заполнить форму текущей работой